Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/RHH(antitoxin) |
Location | 4964971..4965524 | Replicon | chromosome |
Accession | NZ_CP106742 | ||
Organism | Pseudomonas aeruginosa strain PALA14 |
Toxin (Protein)
Gene name | parE | Uniprot ID | Q88JZ3 |
Locus tag | PALA14_RS23505 | Protein ID | WP_010953434.1 |
Coordinates | 4964971..4965264 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q88JZ4 |
Locus tag | PALA14_RS23510 | Protein ID | WP_010953433.1 |
Coordinates | 4965252..4965524 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA14_RS23495 (PALA14_04623) | 4960350..4963130 | - | 2781 | WP_023464835.1 | type I restriction-modification enzyme R subunit C-terminal domain-containing protein | - |
PALA14_RS23500 (PALA14_04624) | 4963568..4964977 | + | 1410 | WP_010953435.1 | site-specific integrase | - |
PALA14_RS23505 | 4964971..4965264 | - | 294 | WP_010953434.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PALA14_RS23510 (PALA14_04625) | 4965252..4965524 | - | 273 | WP_010953433.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PALA14_RS23515 (PALA14_04626) | 4965649..4965894 | - | 246 | WP_010953432.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
PALA14_RS23520 (PALA14_04627) | 4966099..4966428 | + | 330 | WP_010953431.1 | hypothetical protein | - |
PALA14_RS23525 (PALA14_04628) | 4966526..4967494 | + | 969 | WP_031299399.1 | DUF932 domain-containing protein | - |
PALA14_RS23530 (PALA14_04629) | 4967574..4968578 | + | 1005 | WP_010953429.1 | YqaJ viral recombinase family protein | - |
PALA14_RS23535 (PALA14_04630) | 4968671..4969621 | + | 951 | WP_031299400.1 | hypothetical protein | - |
PALA14_RS23540 (PALA14_04631) | 4969593..4969952 | + | 360 | Protein_4647 | DNA repair protein RadC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4939629..4994938 | 55309 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11155.61 Da Isoelectric Point: 5.9081
>T259663 WP_010953434.1 NZ_CP106742:c4965264-4964971 [Pseudomonas aeruginosa]
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
VPRLIVTEGAAKGLERCRRFLSDKDPQVARRAAQAIERQFARLEESPEVGRPFPDLPELRELIIEFGDSGYVALYRYERA
DDTAYVLAFRHQKEAGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2W5CNE8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q88JZ4 |