Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 2578209..2578795 | Replicon | chromosome |
| Accession | NZ_CP106742 | ||
| Organism | Pseudomonas aeruginosa strain PALA14 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | G8CP73 |
| Locus tag | PALA14_RS12205 | Protein ID | WP_003120987.1 |
| Coordinates | 2578209..2578508 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | PALA14_RS12210 | Protein ID | WP_003448662.1 |
| Coordinates | 2578505..2578795 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA14_RS12185 (PALA14_02400) | 2573322..2573855 | - | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
| PALA14_RS12190 (PALA14_02401) | 2573845..2575170 | - | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
| PALA14_RS12195 (PALA14_02402) | 2575174..2576883 | - | 1710 | WP_012076860.1 | PilN family type IVB pilus formation outer membrane protein | - |
| PALA14_RS12200 (PALA14_02403) | 2576883..2578007 | - | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
| PALA14_RS12205 (PALA14_02404) | 2578209..2578508 | + | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PALA14_RS12210 (PALA14_02405) | 2578505..2578795 | + | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
| PALA14_RS12215 | 2578866..2579210 | - | 345 | WP_016851612.1 | hypothetical protein | - |
| PALA14_RS12220 (PALA14_02406) | 2579351..2581327 | - | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
| PALA14_RS12225 (PALA14_02407) | 2581324..2583213 | - | 1890 | WP_016851610.1 | hypothetical protein | - |
| PALA14_RS12230 (PALA14_02408) | 2583435..2583644 | - | 210 | WP_003105733.1 | cold-shock protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 2513859..2606686 | 92827 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T259660 WP_003120987.1 NZ_CP106742:2578209-2578508 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|