Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 88452..89028 | Replicon | plasmid unnamed2 |
Accession | NZ_CP106737 | ||
Organism | Roseovarius sp. HL-MP18 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N7U68_RS00415 | Protein ID | WP_263046752.1 |
Coordinates | 88738..89028 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A840CDQ2 |
Locus tag | N7U68_RS00410 | Protein ID | WP_074838673.1 |
Coordinates | 88452..88751 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7U68_RS00385 (N7U68_00385) | 83504..84298 | + | 795 | WP_263046748.1 | pyrroline-5-carboxylate reductase dimerization domain-containing protein | - |
N7U68_RS00390 (N7U68_00390) | 84494..84883 | + | 390 | WP_263046749.1 | DUF3768 domain-containing protein | - |
N7U68_RS00395 (N7U68_00395) | 85039..87021 | + | 1983 | WP_263046750.1 | ParB/RepB/Spo0J family partition protein | - |
N7U68_RS00400 (N7U68_00400) | 87098..87691 | + | 594 | WP_121068269.1 | regulator | - |
N7U68_RS00405 (N7U68_00405) | 87691..88347 | + | 657 | WP_263046751.1 | hypothetical protein | - |
N7U68_RS00410 (N7U68_00410) | 88452..88751 | + | 300 | WP_074838673.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N7U68_RS00415 (N7U68_00415) | 88738..89028 | + | 291 | WP_263046752.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7U68_RS00420 (N7U68_00420) | 89135..93397 | + | 4263 | WP_263046753.1 | strawberry notch family protein | - |
N7U68_RS00425 (N7U68_00425) | 93520..93906 | + | 387 | WP_263046754.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..242241 | 242241 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10886.43 Da Isoelectric Point: 4.3516
>T259657 WP_263046752.1 NZ_CP106737:88738-89028 [Roseovarius sp. HL-MP18]
MPNLDGPDLEWKATAIADLLAIIDYISDDNPDAAQVLKDEIEHKTSLLPERPQMYRAGRVDGTREMVVRPNYIVVYAESP
EMVTILRVLHAAQQWP
MPNLDGPDLEWKATAIADLLAIIDYISDDNPDAAQVLKDEIEHKTSLLPERPQMYRAGRVDGTREMVVRPNYIVVYAESP
EMVTILRVLHAAQQWP
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|