Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 74312..74924 | Replicon | plasmid unnamed2 |
Accession | NZ_CP106737 | ||
Organism | Roseovarius sp. HL-MP18 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N7U68_RS00335 | Protein ID | WP_263046739.1 |
Coordinates | 74312..74707 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N7U68_RS00340 | Protein ID | WP_263046740.1 |
Coordinates | 74697..74924 (-) | Length | 76 a.a. |
Genomic Context
Location: 71566..72675 (1110 bp)
Type: Others
Protein ID: WP_263046737.1
Type: Others
Protein ID: WP_263046737.1
Location: 73357..74250 (894 bp)
Type: Others
Protein ID: WP_263046738.1
Type: Others
Protein ID: WP_263046738.1
Location: 75616..76800 (1185 bp)
Type: Others
Protein ID: WP_263046741.1
Type: Others
Protein ID: WP_263046741.1
Location: 76800..77771 (972 bp)
Type: Others
Protein ID: WP_263046742.1
Type: Others
Protein ID: WP_263046742.1
Location: 78012..79307 (1296 bp)
Type: Others
Protein ID: WP_263046743.1
Type: Others
Protein ID: WP_263046743.1
Location: 69884..70420 (537 bp)
Type: Others
Protein ID: WP_263046777.1
Type: Others
Protein ID: WP_263046777.1
Location: 70499..71452 (954 bp)
Type: Others
Protein ID: WP_263046736.1
Type: Others
Protein ID: WP_263046736.1
Location: 72680..73003 (324 bp)
Type: Others
Protein ID: WP_165198350.1
Type: Others
Protein ID: WP_165198350.1
Location: 72990..73235 (246 bp)
Type: Others
Protein ID: WP_165198351.1
Type: Others
Protein ID: WP_165198351.1
Location: 74312..74707 (396 bp)
Type: Toxin
Protein ID: WP_263046739.1
Type: Toxin
Protein ID: WP_263046739.1
Location: 74697..74924 (228 bp)
Type: Antitoxin
Protein ID: WP_263046740.1
Type: Antitoxin
Protein ID: WP_263046740.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7U68_RS00305 (N7U68_00305) | 69884..70420 | - | 537 | WP_263046777.1 | SMC-Scp complex subunit ScpB | - |
N7U68_RS00310 (N7U68_00310) | 70499..71452 | - | 954 | WP_263046736.1 | DUF1403 family protein | - |
N7U68_RS00315 (N7U68_00315) | 71566..72675 | + | 1110 | WP_263046737.1 | tyrosine-type recombinase/integrase | - |
N7U68_RS00320 (N7U68_00320) | 72680..73003 | - | 324 | WP_165198350.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N7U68_RS00325 (N7U68_00325) | 72990..73235 | - | 246 | WP_165198351.1 | type II toxin-antitoxin system ParD family antitoxin | - |
N7U68_RS00330 (N7U68_00330) | 73357..74250 | + | 894 | WP_263046738.1 | recombinase family protein | - |
N7U68_RS00335 (N7U68_00335) | 74312..74707 | - | 396 | WP_263046739.1 | PIN domain-containing protein | Toxin |
N7U68_RS00340 (N7U68_00340) | 74697..74924 | - | 228 | WP_263046740.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
N7U68_RS00345 (N7U68_00345) | 75616..76800 | + | 1185 | WP_263046741.1 | plasmid partitioning protein RepA | - |
N7U68_RS00350 (N7U68_00350) | 76800..77771 | + | 972 | WP_263046742.1 | plasmid partitioning protein RepB | - |
N7U68_RS00355 (N7U68_00355) | 78012..79307 | + | 1296 | WP_263046743.1 | plasmid replication protein RepC | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..242241 | 242241 | |
- | flank | IS/Tn | - | - | 69003..69728 | 725 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14286.30 Da Isoelectric Point: 4.1547
>T259656 WP_263046739.1 NZ_CP106737:c74707-74312 [Roseovarius sp. HL-MP18]
MSAEFADTNVVLYLLDDGPKADRAEDILGQGPRISVQVLNEAMVNCRRKAGLSWEETGAFLAGVQSLCPVEDLSVQTHLV
GRALAEKYQLSVYDAMIVSAALIAGCTTLWSEDMHDGLLVEDQLRVMNPFT
MSAEFADTNVVLYLLDDGPKADRAEDILGQGPRISVQVLNEAMVNCRRKAGLSWEETGAFLAGVQSLCPVEDLSVQTHLV
GRALAEKYQLSVYDAMIVSAALIAGCTTLWSEDMHDGLLVEDQLRVMNPFT
Download Length: 396 bp