Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
| Location | 356389..357116 | Replicon | chromosome |
| Accession | NZ_CP106736 | ||
| Organism | Silvimonas sp. 17_6 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | N7220_RS01550 | Protein ID | WP_283149714.1 |
| Coordinates | 356389..356574 (+) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N7220_RS01555 | Protein ID | WP_283149715.1 |
| Coordinates | 356697..357116 (+) | Length | 140 a.a. |
Genomic Context
Location: 352127..352870 (744 bp)
Type: Others
Protein ID: WP_283149710.1
Type: Others
Protein ID: WP_283149710.1
Location: 352904..353194 (291 bp)
Type: Others
Protein ID: WP_283149711.1
Type: Others
Protein ID: WP_283149711.1
Location: 353244..353906 (663 bp)
Type: Others
Protein ID: WP_283149712.1
Type: Others
Protein ID: WP_283149712.1
Location: 353947..356223 (2277 bp)
Type: Others
Protein ID: WP_283149713.1
Type: Others
Protein ID: WP_283149713.1
Location: 356389..356574 (186 bp)
Type: Toxin
Protein ID: WP_283149714.1
Type: Toxin
Protein ID: WP_283149714.1
Location: 356697..357116 (420 bp)
Type: Antitoxin
Protein ID: WP_283149715.1
Type: Antitoxin
Protein ID: WP_283149715.1
Location: 358461..358979 (519 bp)
Type: Others
Protein ID: WP_283149717.1
Type: Others
Protein ID: WP_283149717.1
Location: 357258..358058 (801 bp)
Type: Others
Protein ID: WP_283149716.1
Type: Others
Protein ID: WP_283149716.1
Location: 359069..359557 (489 bp)
Type: Others
Protein ID: WP_283149718.1
Type: Others
Protein ID: WP_283149718.1
Location: 359618..359911 (294 bp)
Type: Others
Protein ID: WP_283149719.1
Type: Others
Protein ID: WP_283149719.1
Location: 359908..360246 (339 bp)
Type: Others
Protein ID: WP_283149720.1
Type: Others
Protein ID: WP_283149720.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7220_RS01530 | 352127..352870 | + | 744 | WP_283149710.1 | SOS response-associated peptidase | - |
| N7220_RS01535 | 352904..353194 | + | 291 | WP_283149711.1 | hypothetical protein | - |
| N7220_RS01540 | 353244..353906 | + | 663 | WP_283149712.1 | SOS response-associated peptidase family protein | - |
| N7220_RS01545 | 353947..356223 | + | 2277 | WP_283149713.1 | P-loop NTPase fold protein | - |
| N7220_RS01550 | 356389..356574 | + | 186 | WP_283149714.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N7220_RS01555 | 356697..357116 | + | 420 | WP_283149715.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N7220_RS01560 | 357258..358058 | - | 801 | WP_283149716.1 | DNA adenine methylase | - |
| N7220_RS01565 | 358461..358979 | + | 519 | WP_283149717.1 | hypothetical protein | - |
| N7220_RS01570 | 359069..359557 | - | 489 | WP_283149718.1 | M23 family metallopeptidase | - |
| N7220_RS01575 | 359618..359911 | - | 294 | WP_283149719.1 | hypothetical protein | - |
| N7220_RS01580 | 359908..360246 | - | 339 | WP_283149720.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 352127..399206 | 47079 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6918.99 Da Isoelectric Point: 10.9319
>T259654 WP_283149714.1 NZ_CP106736:356389-356574 [Silvimonas sp. 17_6]
MKYSEFRKWLKQQGATFEKHRAGSSHYRVTLNGKTTIFPDHGSKEIGTGLVQAIKKQLGVK
MKYSEFRKWLKQQGATFEKHRAGSSHYRVTLNGKTTIFPDHGSKEIGTGLVQAIKKQLGVK
Download Length: 186 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15665.19 Da Isoelectric Point: 5.2525
>AT259654 WP_283149715.1 NZ_CP106736:356697-357116 [Silvimonas sp. 17_6]
MLTYPVSLTRDDNDTFLVTFPDIPEAITVGDDEPQALASALEALEAALDIYFDEKRQIPMPSKIGRDHRTVTLPVLVTAK
VFLANEMLRQGVKKSELARRMDIHMPQVDRLLDLKHSSKIELVEVALQKLGKRLDITVN
MLTYPVSLTRDDNDTFLVTFPDIPEAITVGDDEPQALASALEALEAALDIYFDEKRQIPMPSKIGRDHRTVTLPVLVTAK
VFLANEMLRQGVKKSELARRMDIHMPQVDRLLDLKHSSKIELVEVALQKLGKRLDITVN
Download Length: 420 bp