Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 657190..657749 | Replicon | chromosome |
Accession | NZ_CP106735 | ||
Organism | Reichenbachiella sp. Wsw4-B4 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | N7E81_RS02395 | Protein ID | WP_263053117.1 |
Coordinates | 657190..657459 (+) | Length | 90 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N7E81_RS02400 | Protein ID | WP_263051685.1 |
Coordinates | 657462..657749 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E81_RS02370 (N7E81_02370) | 652745..653167 | + | 423 | WP_263051681.1 | immunity 63 family protein | - |
N7E81_RS02375 (N7E81_02375) | 653448..654467 | - | 1020 | WP_263049646.1 | IS110 family transposase | - |
N7E81_RS02380 (N7E81_02380) | 654737..654985 | + | 249 | WP_263051682.1 | type II toxin-antitoxin system ParD family antitoxin | - |
N7E81_RS02385 (N7E81_02385) | 654978..655274 | + | 297 | WP_263051683.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
N7E81_RS02390 (N7E81_02390) | 655525..656979 | + | 1455 | WP_263051684.1 | hypothetical protein | - |
N7E81_RS02395 (N7E81_02395) | 657190..657459 | + | 270 | WP_263053117.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7E81_RS02400 (N7E81_02400) | 657462..657749 | + | 288 | WP_263051685.1 | putative addiction module antidote protein | Antitoxin |
N7E81_RS02405 (N7E81_02405) | 658243..658623 | - | 381 | WP_263051686.1 | hypothetical protein | - |
N7E81_RS02410 (N7E81_02410) | 658620..659147 | - | 528 | WP_263051687.1 | hypothetical protein | - |
N7E81_RS02415 (N7E81_02415) | 659498..660373 | + | 876 | WP_263051688.1 | META domain-containing protein | - |
N7E81_RS02420 (N7E81_02420) | 660941..661591 | + | 651 | WP_263051689.1 | peroxiredoxin-like family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10530.17 Da Isoelectric Point: 10.2492
>T259652 WP_263053117.1 NZ_CP106735:657190-657459 [Reichenbachiella sp. Wsw4-B4]
MRKLKDKRAKAKILFRIQRIEEHGNFGDCEPVGQGISELRIHYAKGYRVYLKDVNGRIVFLLNRGDKSSQHKDIDKAKQL
WLDYKNEIE
MRKLKDKRAKAKILFRIQRIEEHGNFGDCEPVGQGISELRIHYAKGYRVYLKDVNGRIVFLLNRGDKSSQHKDIDKAKQL
WLDYKNEIE
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|