Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 3728862..3729904 | Replicon | chromosome |
Accession | NZ_CP106682 | ||
Organism | Pseudomonas aeruginosa strain PALA13 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PALA13_RS17305 | Protein ID | WP_003050248.1 |
Coordinates | 3728862..3729437 (-) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PALA13_RS17310 | Protein ID | WP_003050245.1 |
Coordinates | 3729434..3729904 (-) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA13_RS17280 (PALA13_03436) | 3725302..3726027 | - | 726 | WP_023087304.1 | CBASS effector endonuclease NucC | - |
PALA13_RS17285 (PALA13_03437) | 3726064..3726966 | - | 903 | WP_023087303.1 | CBASS oligonucleotide cyclase | - |
PALA13_RS17290 (PALA13_03438) | 3726966..3727466 | - | 501 | WP_003050262.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PALA13_RS17295 (PALA13_03439) | 3727463..3727933 | - | 471 | WP_023087302.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PALA13_RS17300 (PALA13_03440) | 3727930..3728844 | - | 915 | WP_023087301.1 | AAA family ATPase | - |
PALA13_RS17305 (PALA13_03441) | 3728862..3729437 | - | 576 | WP_003050248.1 | PIN domain-containing protein | Toxin |
PALA13_RS17310 (PALA13_03442) | 3729434..3729904 | - | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PALA13_RS17315 (PALA13_03443) | 3730108..3730491 | + | 384 | WP_023087300.1 | RAQPRD family integrative conjugative element protein | - |
PALA13_RS17320 (PALA13_03444) | 3730488..3730721 | + | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
PALA13_RS17325 (PALA13_03445) | 3730738..3731097 | + | 360 | WP_021195311.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PALA13_RS17330 (PALA13_03446) | 3731110..3731508 | + | 399 | WP_003105639.1 | TIGR03750 family conjugal transfer protein | - |
PALA13_RS17335 (PALA13_03447) | 3731505..3732197 | + | 693 | WP_023087299.1 | TIGR03746 family integrating conjugative element protein | - |
PALA13_RS17340 (PALA13_03448) | 3732194..3733105 | + | 912 | WP_023087298.1 | TIGR03749 family integrating conjugative element protein | - |
PALA13_RS17345 (PALA13_03449) | 3733095..3734513 | + | 1419 | WP_023087297.1 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 3683374..3798590 | 115216 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21630.76 Da Isoelectric Point: 5.6130
>T259649 WP_003050248.1 NZ_CP106682:c3729437-3728862 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPDDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT259649 WP_003050245.1 NZ_CP106682:c3729904-3729434 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|