Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1036249..1036889 | Replicon | chromosome |
| Accession | NZ_CP106682 | ||
| Organism | Pseudomonas aeruginosa strain PALA13 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PALA13_RS04845 | Protein ID | WP_003105740.1 |
| Coordinates | 1036479..1036889 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q6X2S2 |
| Locus tag | PALA13_RS04840 | Protein ID | WP_003158175.1 |
| Coordinates | 1036249..1036479 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PALA13_RS04825 (PALA13_00954) | 1031447..1033336 | - | 1890 | WP_003105732.1 | hypothetical protein | - |
| PALA13_RS04830 | 1033557..1033766 | - | 210 | WP_003105733.1 | cold-shock protein | - |
| PALA13_RS04835 (PALA13_00955) | 1034074..1035993 | - | 1920 | WP_004352838.1 | type I DNA topoisomerase | - |
| PALA13_RS04840 (PALA13_00956) | 1036249..1036479 | + | 231 | WP_003158175.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PALA13_RS04845 (PALA13_00957) | 1036479..1036889 | + | 411 | WP_003105740.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PALA13_RS04850 | 1036911..1037171 | + | 261 | WP_003105742.1 | hypothetical protein | - |
| PALA13_RS04855 (PALA13_00959) | 1037371..1037589 | + | 219 | WP_003105747.1 | hypothetical protein | - |
| PALA13_RS04860 | 1037655..1037852 | - | 198 | WP_003109353.1 | CrpP family ICE-associated protein | - |
| PALA13_RS04865 (PALA13_00960) | 1038008..1038496 | - | 489 | WP_003105748.1 | single-stranded DNA-binding protein | - |
| PALA13_RS04870 (PALA13_00961) | 1038526..1039365 | - | 840 | WP_003105750.1 | Rha family transcriptional regulator | - |
| PALA13_RS04875 (PALA13_00962) | 1039412..1039960 | - | 549 | WP_003105753.1 | DUF3158 family protein | - |
| PALA13_RS04880 (PALA13_00963) | 1039966..1040694 | - | 729 | WP_003105754.1 | TIGR03761 family integrating conjugative element protein | - |
| PALA13_RS04885 (PALA13_00964) | 1040850..1041020 | - | 171 | WP_003159716.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 952883..1056232 | 103349 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15450.81 Da Isoelectric Point: 7.3233
>T259646 WP_003105740.1 NZ_CP106682:1036479-1036889 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVVPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|