Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 141180..141685 Replicon chromosome
Accession NZ_CP106682
Organism Pseudomonas aeruginosa strain PALA13

Toxin (Protein)


Gene name parE Uniprot ID A0A7M2ZNP4
Locus tag PALA13_RS00640 Protein ID WP_009875660.1
Coordinates 141180..141461 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A0H2ZJU8
Locus tag PALA13_RS00645 Protein ID WP_003137009.1
Coordinates 141458..141685 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA13_RS00615 (PALA13_00122) 136431..137780 + 1350 WP_003142411.1 C4-dicarboxylate transporter DctA -
PALA13_RS00620 (PALA13_00123) 137829..138515 + 687 WP_004351997.1 FadR/GntR family transcriptional regulator -
PALA13_RS00625 (PALA13_00124) 138616..139350 + 735 WP_003117208.1 GntR family transcriptional regulator -
PALA13_RS00630 (PALA13_00125) 139530..139940 + 411 WP_003101225.1 aegerolysin family protein -
PALA13_RS00635 (PALA13_00126) 139972..140880 - 909 WP_003083769.1 LysR family transcriptional regulator -
PALA13_RS00640 (PALA13_00127) 141180..141461 - 282 WP_009875660.1 type II toxin-antitoxin system toxin ParE Toxin
PALA13_RS00645 (PALA13_00128) 141458..141685 - 228 WP_003137009.1 CopG family ribbon-helix-helix protein Antitoxin
PALA13_RS00650 (PALA13_00129) 141861..142481 - 621 WP_023086863.1 hypothetical protein -
PALA13_RS00655 (PALA13_00130) 142582..143082 + 501 WP_003101228.1 LEA type 2 family protein -
PALA13_RS00660 (PALA13_00131) 143155..143496 + 342 WP_003101229.1 zinc ribbon domain-containing protein YjdM -
PALA13_RS00665 (PALA13_00132) 143578..145005 - 1428 WP_003083784.1 GABA permease -
PALA13_RS00670 (PALA13_00133) 145174..146667 - 1494 WP_003101230.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10461.25 Da        Isoelectric Point: 10.4670

>T259644 WP_009875660.1 NZ_CP106682:c141461-141180 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLKRWPFSAPFRVKGKE
IQILRIDRVEITP

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8526.56 Da        Isoelectric Point: 5.5740

>AT259644 WP_003137009.1 NZ_CP106682:c141685-141458 [Pseudomonas aeruginosa]
MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHAEIEKRWGLQ

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7M2ZNP4

Antitoxin

Source ID Structure
AlphaFold DB A0A0H2ZJU8

References