Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RHH(antitoxin)
Location 5438327..5438832 Replicon chromosome
Accession NZ_CP106681
Organism Pseudomonas aeruginosa strain PALA12

Toxin (Protein)


Gene name parE Uniprot ID A0A069QL22
Locus tag PALA12_RS25155 Protein ID WP_003121619.1
Coordinates 5438551..5438832 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A1C7BDS9
Locus tag PALA12_RS25150 Protein ID WP_003083775.1
Coordinates 5438327..5438554 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PALA12_RS25125 (PALA12_04977) 5433345..5434838 + 1494 WP_003101230.1 CoA-acylating methylmalonate-semialdehyde dehydrogenase -
PALA12_RS25130 (PALA12_04978) 5435007..5436434 + 1428 WP_003083784.1 GABA permease -
PALA12_RS25135 (PALA12_04979) 5436516..5436857 - 342 WP_003101229.1 zinc ribbon domain-containing protein YjdM -
PALA12_RS25140 (PALA12_04980) 5436930..5437430 - 501 WP_003101228.1 LEA type 2 family protein -
PALA12_RS25145 (PALA12_04981) 5437531..5438151 + 621 WP_003101226.1 hypothetical protein -
PALA12_RS25150 (PALA12_04982) 5438327..5438554 + 228 WP_003083775.1 CopG family ribbon-helix-helix protein Antitoxin
PALA12_RS25155 (PALA12_04983) 5438551..5438832 + 282 WP_003121619.1 type II toxin-antitoxin system toxin ParE Toxin
PALA12_RS25160 (PALA12_04984) 5439132..5440040 + 909 WP_023083551.1 LysR family transcriptional regulator -
PALA12_RS25165 (PALA12_04985) 5440072..5440482 - 411 WP_003101225.1 aegerolysin family protein -
PALA12_RS25170 (PALA12_04986) 5440662..5441396 - 735 WP_003117208.1 GntR family transcriptional regulator -
PALA12_RS25175 (PALA12_04987) 5441497..5442183 - 687 WP_003083762.1 FadR/GntR family transcriptional regulator -
PALA12_RS25180 (PALA12_04988) 5442232..5443581 - 1350 WP_003119513.1 C4-dicarboxylate transporter DctA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-87)

Antitoxin

Ribbon-helix-helix protein, CopG

(5-42)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10492.22 Da        Isoelectric Point: 10.0435

>T259642 WP_003121619.1 NZ_CP106681:5438551-5438832 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP

Download         Length: 282 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8556.58 Da        Isoelectric Point: 5.5740

>AT259642 WP_003083775.1 NZ_CP106681:5438327-5438554 [Pseudomonas aeruginosa]
MSTVVSFRADDALVAALDELARATHRDRPYHLRQALAQYLERQQWQVAAIDEGLADANAGRLLEHTEIEKRWGLQ

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A069QL22

Antitoxin

Source ID Structure
AlphaFold DB A0A1C7BDS9

References