Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2820345..2821387 | Replicon | chromosome |
Accession | NZ_CP106681 | ||
Organism | Pseudomonas aeruginosa strain PALA12 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PALA12_RS12830 | Protein ID | WP_003153636.1 |
Coordinates | 2820345..2820920 (-) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PALA12_RS12835 | Protein ID | WP_003050245.1 |
Coordinates | 2820917..2821387 (-) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA12_RS12805 (PALA12_02528) | 2816783..2817508 | - | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
PALA12_RS12810 (PALA12_02529) | 2817547..2818449 | - | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
PALA12_RS12815 (PALA12_02530) | 2818449..2818949 | - | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PALA12_RS12820 (PALA12_02531) | 2818946..2819416 | - | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PALA12_RS12825 (PALA12_02532) | 2819413..2820327 | - | 915 | WP_016852809.1 | AAA family ATPase | - |
PALA12_RS12830 (PALA12_02533) | 2820345..2820920 | - | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PALA12_RS12835 (PALA12_02534) | 2820917..2821387 | - | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PALA12_RS12840 (PALA12_02535) | 2821591..2821974 | + | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PALA12_RS12845 (PALA12_02536) | 2821971..2822204 | + | 234 | WP_006226027.1 | TIGR03758 family integrating conjugative element protein | - |
PALA12_RS12850 (PALA12_02537) | 2822221..2822580 | + | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PALA12_RS12855 (PALA12_02538) | 2822592..2822990 | + | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
PALA12_RS12860 (PALA12_02539) | 2822987..2823679 | + | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
PALA12_RS12865 (PALA12_02540) | 2823676..2824587 | + | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
PALA12_RS12870 (PALA12_02541) | 2824577..2825995 | + | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2774229..2895962 | 121733 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T259639 WP_003153636.1 NZ_CP106681:c2820920-2820345 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT259639 WP_003050245.1 NZ_CP106681:c2821387-2820917 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|