Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 142213..142718 | Replicon | chromosome |
Accession | NZ_CP106680 | ||
Organism | Pseudomonas aeruginosa strain PALA11 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A069QL22 |
Locus tag | PALA11_RS00650 | Protein ID | WP_003121619.1 |
Coordinates | 142213..142494 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | PALA11_RS00655 | Protein ID | WP_003112628.1 |
Coordinates | 142491..142718 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA11_RS00625 (PALA11_00122) | 137464..138813 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
PALA11_RS00630 (PALA11_00123) | 138862..139548 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
PALA11_RS00635 (PALA11_00124) | 139649..140383 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
PALA11_RS00640 (PALA11_00125) | 140563..140973 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
PALA11_RS00645 (PALA11_00126) | 141005..141913 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
PALA11_RS00650 (PALA11_00127) | 142213..142494 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
PALA11_RS00655 (PALA11_00128) | 142491..142718 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
PALA11_RS00660 (PALA11_00129) | 142894..143514 | - | 621 | WP_003101226.1 | hypothetical protein | - |
PALA11_RS00665 (PALA11_00130) | 143615..144115 | + | 501 | WP_003112629.1 | LEA type 2 family protein | - |
PALA11_RS00670 (PALA11_00131) | 144188..144529 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
PALA11_RS00675 (PALA11_00132) | 144611..146038 | - | 1428 | WP_003083784.1 | GABA permease | - |
PALA11_RS00680 (PALA11_00133) | 146207..147700 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T259631 WP_003121619.1 NZ_CP106680:c142494-142213 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A069QL22 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I707 |