Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yoeB-relB/YoeB-YefM |
Location | 3352894..3353405 | Replicon | chromosome |
Accession | NZ_CP106679 | ||
Organism | Reichenbachiella sp. BKB1-1 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | N6H18_RS14170 | Protein ID | WP_262308933.1 |
Coordinates | 3353145..3353405 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N6H18_RS14165 | Protein ID | WP_262308932.1 |
Coordinates | 3352894..3353148 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N6H18_RS14135 (N6H18_14135) | 3348438..3348644 | - | 207 | WP_262308926.1 | sulfur carrier protein ThiS | - |
N6H18_RS14140 (N6H18_14140) | 3348813..3350135 | - | 1323 | WP_262308927.1 | hypothetical protein | - |
N6H18_RS14145 (N6H18_14145) | 3350205..3350822 | - | 618 | WP_262308928.1 | response regulator transcription factor | - |
N6H18_RS14150 (N6H18_14150) | 3350919..3351761 | - | 843 | WP_262308929.1 | S1-like domain-containing RNA-binding protein | - |
N6H18_RS14155 (N6H18_14155) | 3351792..3352229 | - | 438 | WP_262308930.1 | heme-binding protein | - |
N6H18_RS14160 (N6H18_14160) | 3352374..3352754 | + | 381 | WP_262308931.1 | response regulator | - |
N6H18_RS14165 (N6H18_14165) | 3352894..3353148 | + | 255 | WP_262308932.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
N6H18_RS14170 (N6H18_14170) | 3353145..3353405 | + | 261 | WP_262308933.1 | Txe/YoeB family addiction module toxin | Toxin |
N6H18_RS14175 (N6H18_14175) | 3353756..3354157 | - | 402 | WP_262308934.1 | OsmC family protein | - |
N6H18_RS14180 (N6H18_14180) | 3355977..3356282 | - | 306 | WP_262308935.1 | CRISPR-associated endonuclease Cas2 | - |
N6H18_RS14185 (N6H18_14185) | 3356297..3357214 | - | 918 | WP_262308936.1 | type II CRISPR-associated endonuclease Cas1 | - |
N6H18_RS14190 (N6H18_14190) | 3357296..3357913 | - | 618 | WP_262308937.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10567.37 Da Isoelectric Point: 8.6835
>T259630 WP_262308933.1 NZ_CP106679:3353145-3353405 [Reichenbachiella sp. BKB1-1]
MTKLIKFSSHAWLDYIHWQKSDKEMKQLIDKLCLSILETPYQGLGYPQPLSYELNQIWCRRINMEHRLVYRINKDQIEIL
QCRLHY
MTKLIKFSSHAWLDYIHWQKSDKEMKQLIDKLCLSILETPYQGLGYPQPLSYELNQIWCRRINMEHRLVYRINKDQIEIL
QCRLHY
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|