Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | /SpoIISA(toxin) |
Location | 2297048..2298026 | Replicon | chromosome |
Accession | NZ_CP106675 | ||
Organism | Bacillus cereus strain SRCM116293 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | W8Y388 |
Locus tag | N7988_RS11860 | Protein ID | WP_000624977.1 |
Coordinates | 2297048..2297785 (+) | Length | 246 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | W8YZL5 |
Locus tag | N7988_RS11865 | Protein ID | WP_000237818.1 |
Coordinates | 2297898..2298026 (+) | Length | 43 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7988_RS11835 (N7988_11835) | 2292664..2293071 | + | 408 | WP_000063589.1 | VOC family protein | - |
N7988_RS11840 (N7988_11840) | 2293084..2293473 | + | 390 | Protein_2248 | SAM-dependent methyltransferase | - |
N7988_RS11845 (N7988_11845) | 2293631..2295316 | - | 1686 | WP_058839616.1 | alpha-keto acid decarboxylase family protein | - |
N7988_RS11850 (N7988_11850) | 2295424..2295906 | + | 483 | WP_098348562.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
N7988_RS11855 (N7988_11855) | 2296073..2296810 | + | 738 | WP_000594152.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
N7988_RS11860 (N7988_11860) | 2297048..2297785 | + | 738 | WP_000624977.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
N7988_RS11865 (N7988_11865) | 2297898..2298026 | + | 129 | WP_000237818.1 | hypothetical protein | Antitoxin |
N7988_RS11870 (N7988_11870) | 2298099..2298275 | + | 177 | WP_000852629.1 | stage II sporulation protein SB | - |
N7988_RS11875 (N7988_11875) | 2298294..2298683 | - | 390 | WP_098348563.1 | YxeA family protein | - |
N7988_RS11880 (N7988_11880) | 2298895..2300364 | + | 1470 | WP_065704141.1 | beta-Ala-His dipeptidase | - |
N7988_RS11885 (N7988_11885) | 2300610..2301419 | + | 810 | WP_000678509.1 | papain-like cysteine protease family protein | - |
N7988_RS11890 (N7988_11890) | 2301445..2302047 | + | 603 | WP_000517260.1 | hypothetical protein | - |
N7988_RS11895 (N7988_11895) | 2302288..2302539 | - | 252 | WP_000827560.1 | LuxR C-terminal-related transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 246 a.a. Molecular weight: 28307.03 Da Isoelectric Point: 8.2998
>T259629 WP_000624977.1 NZ_CP106675:2297048-2297785 [Bacillus cereus]
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
MISNIRIGLFVLAIVFVVLVFFYWKNEELYEEKKQRIRKTWYGLFIISVTVYFMIKGIDLTLWKNLLMFTAMVIFVDIAF
ILTPNISEIWGAKFSDIGKTVQSIKRSLIASKARGEIYTTIIQNVNPAVFGTMEWHTEEEYTKSLNAFLDSYGEKIGAKI
VVFEAAKELNTNFRGIRSQFSIIVPLEHIEQLNEQKAVQVENVGIIPAKIVSDVFIVIDGKKNNLQDRDFENVYNLTIHH
SYFSK
Download Length: 738 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|