Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 230768..231410 | Replicon | chromosome |
Accession | NZ_CP106675 | ||
Organism | Bacillus cereus strain SRCM116293 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | R8I8B8 |
Locus tag | N7988_RS01325 | Protein ID | WP_000635965.1 |
Coordinates | 231060..231410 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | N7988_RS01320 | Protein ID | WP_000004570.1 |
Coordinates | 230768..231055 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7988_RS01295 (N7988_01295) | 226085..227047 | + | 963 | WP_098347994.1 | UV DNA damage repair endonuclease UvsE | - |
N7988_RS01300 (N7988_01300) | 227040..227612 | - | 573 | WP_000908523.1 | rhomboid family intramembrane serine protease | - |
N7988_RS01305 (N7988_01305) | 227706..228065 | + | 360 | WP_000583417.1 | holo-ACP synthase | - |
N7988_RS01310 (N7988_01310) | 228222..229172 | + | 951 | WP_002060618.1 | outer membrane lipoprotein carrier protein LolA | - |
N7988_RS01315 (N7988_01315) | 229290..230459 | + | 1170 | WP_262314141.1 | alanine racemase | - |
N7988_RS01320 (N7988_01320) | 230768..231055 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
N7988_RS01325 (N7988_01325) | 231060..231410 | + | 351 | WP_000635965.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
N7988_RS01330 (N7988_01330) | 231478..233646 | + | 2169 | WP_142320223.1 | Tex family protein | - |
N7988_RS01335 (N7988_01335) | 233704..233820 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
N7988_RS01340 (N7988_01340) | 234016..234474 | + | 459 | WP_000344241.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.04 Da Isoelectric Point: 5.7168
>T259628 WP_000635965.1 NZ_CP106675:231060-231410 [Bacillus cereus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMSRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366G118 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |