Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1331858..1332774 | Replicon | chromosome |
Accession | NZ_CP106673 | ||
Organism | Bacillus subtilis strain SRCM116268 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | N7985_RS06995 | Protein ID | WP_003244695.1 |
Coordinates | 1332028..1332774 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | N7985_RS06990 | Protein ID | WP_003232646.1 |
Coordinates | 1331858..1332028 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7985_RS06955 (1328721) | 1328721..1329050 | + | 330 | WP_041850928.1 | XkdW family protein | - |
N7985_RS06960 (1329047) | 1329047..1329211 | + | 165 | WP_041850927.1 | XkdX family protein | - |
N7985_RS06965 (1329255) | 1329255..1330094 | + | 840 | WP_041850926.1 | phage-like element PBSX protein XepA | - |
N7985_RS06970 (1330147) | 1330147..1330416 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
N7985_RS06975 (1330429) | 1330429..1330692 | + | 264 | WP_003232653.1 | phage holin | - |
N7985_RS06980 (1330705) | 1330705..1331598 | + | 894 | WP_041850925.1 | N-acetylmuramoyl-L-alanine amidase | - |
N7985_RS06985 (1331635) | 1331635..1331772 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
N7985_RS06990 (1331858) | 1331858..1332028 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
N7985_RS06995 (1332028) | 1332028..1332774 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
N7985_RS07000 (1332884) | 1332884..1333885 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
N7985_RS07005 (1333898) | 1333898..1334515 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
N7985_RS07010 (1334791) | 1334791..1336107 | - | 1317 | WP_041850924.1 | serine/threonine exchanger | - |
N7985_RS07015 (1336495) | 1336495..1337445 | + | 951 | WP_041344800.1 | ring-cleaving dioxygenase | - |
N7985_RS07020 (1337546) | 1337546..1337692 | + | 147 | WP_120363335.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1296386..1353274 | 56888 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T259623 WP_003244695.1 NZ_CP106673:c1332774-1332028 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|