Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 509454..510090 | Replicon | chromosome |
Accession | NZ_CP106673 | ||
Organism | Bacillus subtilis strain SRCM116268 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | N7985_RS02600 | Protein ID | WP_003156187.1 |
Coordinates | 509740..510090 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | N7985_RS02595 | Protein ID | WP_003225183.1 |
Coordinates | 509454..509735 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7985_RS02575 (505814) | 505814..506413 | - | 600 | WP_041850724.1 | rhomboid family intramembrane serine protease | - |
N7985_RS02580 (506508) | 506508..506873 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
N7985_RS02585 (507039) | 507039..508055 | + | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
N7985_RS02590 (508169) | 508169..509338 | + | 1170 | WP_015252766.1 | alanine racemase | - |
N7985_RS02595 (509454) | 509454..509735 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
N7985_RS02600 (509740) | 509740..510090 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
N7985_RS02605 (510205) | 510205..511029 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
N7985_RS02610 (511034) | 511034..511399 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
N7985_RS02615 (511403) | 511403..511804 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
N7985_RS02620 (511816) | 511816..512823 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
N7985_RS02625 (512885) | 512885..513214 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
N7985_RS02630 (513211) | 513211..513693 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
N7985_RS02635 (513659) | 513659..514447 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
N7985_RS02640 (514447) | 514447..515046 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T259622 WP_003156187.1 NZ_CP106673:509740-510090 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|