Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3583263..3583899 | Replicon | chromosome |
Accession | NZ_CP106671 | ||
Organism | Bacillus subtilis strain SRCM116301 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | N7980_RS18515 | Protein ID | WP_003156187.1 |
Coordinates | 3583263..3583613 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | N7980_RS18520 | Protein ID | WP_003225183.1 |
Coordinates | 3583618..3583899 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7980_RS18475 (3578307) | 3578307..3578906 | - | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
N7980_RS18480 (3578906) | 3578906..3579694 | - | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
N7980_RS18485 (3579660) | 3579660..3580142 | - | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
N7980_RS18490 (3580139) | 3580139..3580468 | - | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
N7980_RS18495 (3580530) | 3580530..3581537 | - | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
N7980_RS18500 (3581549) | 3581549..3581950 | - | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
N7980_RS18505 (3581954) | 3581954..3582319 | - | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
N7980_RS18510 (3582324) | 3582324..3583148 | - | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
N7980_RS18515 (3583263) | 3583263..3583613 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
N7980_RS18520 (3583618) | 3583618..3583899 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
N7980_RS18525 (3584015) | 3584015..3585184 | - | 1170 | WP_015252766.1 | alanine racemase | - |
N7980_RS18530 (3585298) | 3585298..3586314 | - | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
N7980_RS18535 (3586480) | 3586480..3586845 | - | 366 | WP_015252768.1 | holo-ACP synthase | - |
N7980_RS18540 (3586940) | 3586940..3587539 | + | 600 | WP_041850724.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T259621 WP_003156187.1 NZ_CP106671:c3583613-3583263 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|