Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 2760579..2761495 | Replicon | chromosome |
Accession | NZ_CP106671 | ||
Organism | Bacillus subtilis strain SRCM116301 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | N7980_RS14120 | Protein ID | WP_003244695.1 |
Coordinates | 2760579..2761325 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | N7980_RS14125 | Protein ID | WP_003232646.1 |
Coordinates | 2761325..2761495 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7980_RS14095 (2755661) | 2755661..2755807 | - | 147 | WP_120363335.1 | hypothetical protein | - |
N7980_RS14100 (2755908) | 2755908..2756858 | - | 951 | WP_041344800.1 | ring-cleaving dioxygenase | - |
N7980_RS14105 (2757246) | 2757246..2758562 | + | 1317 | WP_041850924.1 | serine/threonine exchanger | - |
N7980_RS14110 (2758838) | 2758838..2759455 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
N7980_RS14115 (2759468) | 2759468..2760469 | + | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
N7980_RS14120 (2760579) | 2760579..2761325 | + | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
N7980_RS14125 (2761325) | 2761325..2761495 | + | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
N7980_RS14130 (2761581) | 2761581..2761718 | + | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
N7980_RS14135 (2761755) | 2761755..2762648 | - | 894 | WP_041850925.1 | N-acetylmuramoyl-L-alanine amidase | - |
N7980_RS14140 (2762661) | 2762661..2762924 | - | 264 | WP_003232653.1 | phage holin | - |
N7980_RS14145 (2762937) | 2762937..2763206 | - | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
N7980_RS14150 (2763259) | 2763259..2764098 | - | 840 | WP_041850926.1 | phage-like element PBSX protein XepA | - |
N7980_RS14155 (2764142) | 2764142..2764306 | - | 165 | WP_041850927.1 | XkdX family protein | - |
N7980_RS14160 (2764303) | 2764303..2764632 | - | 330 | WP_041850928.1 | XkdW family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T259620 WP_003244695.1 NZ_CP106671:2760579-2761325 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|