Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumA-relB/upstrm_HI1419-DUF971
Location 278738..279329 Replicon chromosome
Accession NZ_CP106662
Organism Brucella intermedia strain SG.G2

Toxin (Protein)


Gene name PumA Uniprot ID A0A5N7NV96
Locus tag N8I72_RS01255 Protein ID WP_021586313.1
Coordinates 279039..279329 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID M5JR51
Locus tag N8I72_RS01250 Protein ID WP_006470801.1
Coordinates 278738..279037 (-) Length 100 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N8I72_RS01220 (N8I72_01220) 273813..274616 - 804 WP_051556896.1 IclR family transcriptional regulator -
N8I72_RS01225 (N8I72_01225) 274864..274965 + 102 Protein_241 dehydratase -
N8I72_RS01230 (N8I72_01230) 275027..275761 + 735 WP_021586316.1 SDR family oxidoreductase -
N8I72_RS01235 (N8I72_01235) 275860..276705 + 846 WP_021586315.1 fumarylacetoacetate hydrolase family protein -
N8I72_RS01240 (N8I72_01240) 276773..278050 + 1278 WP_021586314.1 L-fuconate dehydratase -
N8I72_RS01245 (N8I72_01245) 278106..278546 - 441 WP_006465968.1 DMT family transporter -
N8I72_RS01250 (N8I72_01250) 278738..279037 - 300 WP_006470801.1 putative addiction module antidote protein Antitoxin
N8I72_RS01255 (N8I72_01255) 279039..279329 - 291 WP_021586313.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N8I72_RS01265 (N8I72_01265) 279763..279978 - 216 WP_006465970.1 DNA gyrase inhibitor YacG -
N8I72_RS01270 (N8I72_01270) 279987..280613 - 627 WP_006465971.1 Maf-like protein -
N8I72_RS01275 (N8I72_01275) 280642..280860 - 219 WP_002965531.1 translation initiation factor IF-1 -
N8I72_RS01280 (N8I72_01280) 281075..281560 - 486 WP_021586311.1 low molecular weight phosphatase family protein -
N8I72_RS01285 (N8I72_01285) 281567..282049 - 483 WP_006465974.1 UPF0262 family protein -
N8I72_RS01290 (N8I72_01290) 282056..283348 - 1293 WP_021586310.1 histidinol dehydrogenase -
N8I72_RS01295 (N8I72_01295) 283447..283887 - 441 WP_021586309.1 DUF2948 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(1-96)

Antitoxin

Uncharacterized protein HI1420

(4-95)


Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 10845.59 Da        Isoelectric Point: 9.9969

>T259614 WP_021586313.1 NZ_CP106662:c279329-279039 [Brucella intermedia]
MIEVRQTTFFTKWLDELRDTNARLRIVTRIRRMELGNPGDVKSVGEGVSEMRITYGPGYRVYFVSMGSTIVVLLCGGDKS
SQSRDIALAKQMAKEI

Download         Length: 291 bp

Antitoxin


Download         Length: 100 a.a.        Molecular weight: 10639.16 Da        Isoelectric Point: 5.1200

>AT259614 WP_006470801.1 NZ_CP106662:c279037-278738 [Brucella intermedia]
MVLETTRFDVLDHLKTPEERVAYLEAAFEDGDPSLIAHALGDVARSIGMTTVAKEAGITREALYRSLSENGDPKLSTLLG
VMKALGLHLSVTATDKRAA

Download         Length: 300 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5N7NV96

Antitoxin

Source ID Structure
AlphaFold DB M5JR51

References