Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 3601185..3601884 | Replicon | chromosome |
Accession | NZ_CP106660 | ||
Organism | Pantoea dispersa strain ML.8a3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N7977_RS16920 | Protein ID | WP_072208527.1 |
Coordinates | 3601708..3601884 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N7977_RS16915 | Protein ID | WP_058757543.1 |
Coordinates | 3601185..3601589 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7977_RS16900 (N7977_16900) | 3598354..3598593 | + | 240 | WP_262256515.1 | hypothetical protein | - |
N7977_RS16905 (N7977_16905) | 3598688..3600127 | - | 1440 | WP_262258106.1 | PTS N-acetylmuramic acid transporter subunit IIBC | - |
N7977_RS16910 (N7977_16910) | 3600127..3601038 | - | 912 | WP_262256517.1 | N-acetylmuramic acid 6-phosphate etherase | - |
N7977_RS16915 (N7977_16915) | 3601185..3601589 | - | 405 | WP_058757543.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N7977_RS16920 (N7977_16920) | 3601708..3601884 | - | 177 | WP_072208527.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N7977_RS16925 (N7977_16925) | 3602060..3603361 | - | 1302 | WP_021507820.1 | glutamate/aspartate:proton symporter GltP | - |
N7977_RS16930 (N7977_16930) | 3603942..3605897 | + | 1956 | WP_058774926.1 | acetate--CoA ligase | - |
N7977_RS16935 (N7977_16935) | 3606071..3606400 | + | 330 | WP_021313201.1 | DUF485 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6824.11 Da Isoelectric Point: 10.6691
>T259609 WP_072208527.1 NZ_CP106660:c3601884-3601708 [Pantoea dispersa]
MSSRELIRMLLERGWILDRVKGSHHVFVRADKPYHISLPHPEKDLATGTLRKLLKMMD
MSSRELIRMLLERGWILDRVKGSHHVFVRADKPYHISLPHPEKDLATGTLRKLLKMMD
Download Length: 177 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14655.39 Da Isoelectric Point: 4.9322
>AT259609 WP_058757543.1 NZ_CP106660:c3601589-3601185 [Pantoea dispersa]
MRFPVYLHKTENGSWSGFVPDVQGCFFAGNTVDEALSDAFGAIDAHVESLADAGKAIPKAASVETHINDEECQGGYWAFV
EIDLSRYEGKAVKLNITLPQNLLTKIDSHVEAHREYGSRSGFLAALARRELANI
MRFPVYLHKTENGSWSGFVPDVQGCFFAGNTVDEALSDAFGAIDAHVESLADAGKAIPKAASVETHINDEECQGGYWAFV
EIDLSRYEGKAVKLNITLPQNLLTKIDSHVEAHREYGSRSGFLAALARRELANI
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|