Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 2988000..2988620 | Replicon | chromosome |
| Accession | NZ_CP106660 | ||
| Organism | Pantoea dispersa strain ML.8a3 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A246NIG6 |
| Locus tag | N7977_RS14140 | Protein ID | WP_021507203.1 |
| Coordinates | 2988402..2988620 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A246NI99 |
| Locus tag | N7977_RS14135 | Protein ID | WP_021313568.1 |
| Coordinates | 2988000..2988377 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7977_RS14105 (N7977_14105) | 2984323..2984580 | + | 258 | WP_021507208.1 | type B 50S ribosomal protein L31 | - |
| N7977_RS14110 (N7977_14110) | 2984596..2984736 | + | 141 | WP_010616859.1 | type B 50S ribosomal protein L36 | - |
| N7977_RS14115 (N7977_14115) | 2984781..2985659 | - | 879 | WP_058769397.1 | metal ABC transporter substrate-binding protein | - |
| N7977_RS14120 (N7977_14120) | 2985681..2986520 | - | 840 | WP_021507206.1 | metal ABC transporter permease | - |
| N7977_RS14125 (N7977_14125) | 2986517..2987173 | - | 657 | WP_021507205.1 | ABC transporter ATP-binding protein | - |
| N7977_RS14130 (N7977_14130) | 2987501..2987854 | + | 354 | WP_031279656.1 | hypothetical protein | - |
| N7977_RS14135 (N7977_14135) | 2988000..2988377 | + | 378 | WP_021313568.1 | Hha toxicity modulator TomB | Antitoxin |
| N7977_RS14140 (N7977_14140) | 2988402..2988620 | + | 219 | WP_021507203.1 | HHA domain-containing protein | Toxin |
| N7977_RS14150 (N7977_14150) | 2989022..2989333 | + | 312 | WP_021507202.1 | MGMT family protein | - |
| N7977_RS14155 (N7977_14155) | 2989501..2990058 | - | 558 | WP_021507201.1 | YbaY family lipoprotein | - |
| N7977_RS14160 (N7977_14160) | 2990074..2990265 | + | 192 | WP_153010201.1 | hypothetical protein | - |
| N7977_RS14165 (N7977_14165) | 2990262..2991125 | + | 864 | WP_262256354.1 | acyl-CoA thioesterase II | - |
| N7977_RS14170 (N7977_14170) | 2991198..2992487 | - | 1290 | WP_058757951.1 | ammonium transporter AmtB | - |
| N7977_RS14175 (N7977_14175) | 2992521..2992859 | - | 339 | WP_007886947.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8538.87 Da Isoelectric Point: 8.8662
>T259606 WP_021507203.1 NZ_CP106660:2988402-2988620 [Pantoea dispersa]
MSNPALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDDELAVFYSAADHRLAELTMNKLYDKVPGSVWKYVR
MSNPALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDDELAVFYSAADHRLAELTMNKLYDKVPGSVWKYVR
Download Length: 219 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14665.34 Da Isoelectric Point: 4.4796
>AT259606 WP_021313568.1 NZ_CP106660:2988000-2988377 [Pantoea dispersa]
MDEYSPKRHDIAQLKFLCENLFDESMATLTDSHHGWVNDPTSPGNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF
MDEYSPKRHDIAQLKFLCENLFDESMATLTDSHHGWVNDPTSPGNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246NIG6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A246NI99 |