Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 2988000..2988620 Replicon chromosome
Accession NZ_CP106660
Organism Pantoea dispersa strain ML.8a3

Toxin (Protein)


Gene name Hha Uniprot ID A0A246NIG6
Locus tag N7977_RS14140 Protein ID WP_021507203.1
Coordinates 2988402..2988620 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A246NI99
Locus tag N7977_RS14135 Protein ID WP_021313568.1
Coordinates 2988000..2988377 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7977_RS14105 (N7977_14105) 2984323..2984580 + 258 WP_021507208.1 type B 50S ribosomal protein L31 -
N7977_RS14110 (N7977_14110) 2984596..2984736 + 141 WP_010616859.1 type B 50S ribosomal protein L36 -
N7977_RS14115 (N7977_14115) 2984781..2985659 - 879 WP_058769397.1 metal ABC transporter substrate-binding protein -
N7977_RS14120 (N7977_14120) 2985681..2986520 - 840 WP_021507206.1 metal ABC transporter permease -
N7977_RS14125 (N7977_14125) 2986517..2987173 - 657 WP_021507205.1 ABC transporter ATP-binding protein -
N7977_RS14130 (N7977_14130) 2987501..2987854 + 354 WP_031279656.1 hypothetical protein -
N7977_RS14135 (N7977_14135) 2988000..2988377 + 378 WP_021313568.1 Hha toxicity modulator TomB Antitoxin
N7977_RS14140 (N7977_14140) 2988402..2988620 + 219 WP_021507203.1 HHA domain-containing protein Toxin
N7977_RS14150 (N7977_14150) 2989022..2989333 + 312 WP_021507202.1 MGMT family protein -
N7977_RS14155 (N7977_14155) 2989501..2990058 - 558 WP_021507201.1 YbaY family lipoprotein -
N7977_RS14160 (N7977_14160) 2990074..2990265 + 192 WP_153010201.1 hypothetical protein -
N7977_RS14165 (N7977_14165) 2990262..2991125 + 864 WP_262256354.1 acyl-CoA thioesterase II -
N7977_RS14170 (N7977_14170) 2991198..2992487 - 1290 WP_058757951.1 ammonium transporter AmtB -
N7977_RS14175 (N7977_14175) 2992521..2992859 - 339 WP_007886947.1 P-II family nitrogen regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-114)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8538.87 Da        Isoelectric Point: 8.8662

>T259606 WP_021507203.1 NZ_CP106660:2988402-2988620 [Pantoea dispersa]
MSNPALTKTDYLMRLRRCRSIDTLERVIEKNKYELPDDELAVFYSAADHRLAELTMNKLYDKVPGSVWKYVR

Download         Length: 219 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 14665.34 Da        Isoelectric Point: 4.4796

>AT259606 WP_021313568.1 NZ_CP106660:2988000-2988377 [Pantoea dispersa]
MDEYSPKRHDIAQLKFLCENLFDESMATLTDSHHGWVNDPTSPGNLQLNDLIEHIASFTMNYKIKHVEDEALITQIDEYL
DDTFMLFSSYGINTQDLQRWQRSAKRLFNLFAEECAYLQQPSHSF

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A246NIG6

Antitoxin

Source ID Structure
AlphaFold DB A0A246NI99

References