Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2406919..2407533 | Replicon | chromosome |
| Accession | NZ_CP106660 | ||
| Organism | Pantoea dispersa strain ML.8a3 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A246NCD7 |
| Locus tag | N7977_RS11250 | Protein ID | WP_058757609.1 |
| Coordinates | 2406919..2407101 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | N7977_RS11255 | Protein ID | WP_022548759.1 |
| Coordinates | 2407141..2407533 (+) | Length | 131 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7977_RS11200 (N7977_11200) | 2402064..2402726 | + | 663 | WP_021506360.1 | MBL fold metallo-hydrolase | - |
| N7977_RS11205 (N7977_11205) | 2402727..2403140 | - | 414 | WP_262255901.1 | GNAT family N-acetyltransferase | - |
| N7977_RS11210 (N7977_11210) | 2403162..2403545 | - | 384 | WP_058780734.1 | hypothetical protein | - |
| N7977_RS11215 (N7977_11215) | 2403763..2404119 | + | 357 | WP_010617204.1 | DUF4186 domain-containing protein | - |
| N7977_RS11220 (N7977_11220) | 2404138..2404317 | - | 180 | WP_262255904.1 | hypothetical protein | - |
| N7977_RS11225 (N7977_11225) | 2404521..2404850 | + | 330 | WP_222951040.1 | hypothetical protein | - |
| N7977_RS11230 (N7977_11230) | 2404912..2405460 | + | 549 | WP_058757703.1 | hypothetical protein | - |
| N7977_RS11235 (N7977_11235) | 2405485..2405691 | - | 207 | WP_262255907.1 | DUF2767 family protein | - |
| N7977_RS11240 (N7977_11240) | 2405872..2406120 | + | 249 | WP_021506368.1 | DUF883 family protein | - |
| N7977_RS11245 (N7977_11245) | 2406453..2406650 | - | 198 | WP_021506369.1 | DUF6404 family protein | - |
| N7977_RS11250 (N7977_11250) | 2406919..2407101 | + | 183 | WP_058757609.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| N7977_RS11255 (N7977_11255) | 2407141..2407533 | + | 393 | WP_022548759.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| N7977_RS11260 (N7977_11260) | 2407618..2408874 | + | 1257 | WP_058757608.1 | mechanosensitive ion channel | - |
| N7977_RS11265 (N7977_11265) | 2408997..2410247 | - | 1251 | WP_010617214.1 | NADP-dependent isocitrate dehydrogenase | - |
| N7977_RS11270 (N7977_11270) | 2410349..2411017 | + | 669 | WP_150058306.1 | 23S rRNA pseudouridine(2457) synthase RluE | - |
| N7977_RS11275 (N7977_11275) | 2411062..2411535 | + | 474 | WP_238560978.1 | NUDIX hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6958.19 Da Isoelectric Point: 10.9062
>T259605 WP_058757609.1 NZ_CP106660:2406919-2407101 [Pantoea dispersa]
MKSATLIKLLQKNGWKLERIRGSHHQFSHPDFAHLITVPHPQKDMKTGTLMQILKDARLD
MKSATLIKLLQKNGWKLERIRGSHHQFSHPDFAHLITVPHPQKDMKTGTLMQILKDARLD
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 14554.49 Da Isoelectric Point: 4.8732
>AT259605 WP_022548759.1 NZ_CP106660:2407141-2407533 [Pantoea dispersa]
MLFPALVEIDADGSASGYFPDVTGCYFAGDTPEQTLQDAQSALHAHFELMAEKGLLIPEPAQHWQQEFSQPGVWIYVDID
VTRYLGKSERINITMPHLLIEKIDKMVSNNARYSSRSHFLAEAARKALVS
MLFPALVEIDADGSASGYFPDVTGCYFAGDTPEQTLQDAQSALHAHFELMAEKGLLIPEPAQHWQQEFSQPGVWIYVDID
VTRYLGKSERINITMPHLLIEKIDKMVSNNARYSSRSHFLAEAARKALVS
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|