Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
| Location | 66120..66859 | Replicon | plasmid p8BG |
| Accession | NZ_CP106659 | ||
| Organism | Klebsiella michiganensis strain 8BG | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | N7918_RS29045 | Protein ID | WP_262191639.1 |
| Coordinates | 66120..66605 (-) | Length | 162 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | N7918_RS29050 | Protein ID | WP_262191640.1 |
| Coordinates | 66593..66859 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7918_RS29025 (N7918_29025) | 61710..62777 | - | 1068 | WP_262191637.1 | hypothetical protein | - |
| N7918_RS29030 (N7918_29030) | 63467..63844 | + | 378 | WP_262191638.1 | phosphonate ABC transporter substrate-binding protein | - |
| N7918_RS29035 (N7918_29035) | 64042..65016 | - | 975 | WP_064794367.1 | hypothetical protein | - |
| N7918_RS29040 (N7918_29040) | 65619..65777 | - | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
| N7918_RS29045 (N7918_29045) | 66120..66605 | - | 486 | WP_262191639.1 | GNAT family N-acetyltransferase | Toxin |
| N7918_RS29050 (N7918_29050) | 66593..66859 | - | 267 | WP_262191640.1 | DUF1778 domain-containing protein | Antitoxin |
| N7918_RS29055 (N7918_29055) | 67015..68403 | - | 1389 | WP_262191641.1 | MFS transporter | - |
| N7918_RS29060 (N7918_29060) | 68642..69043 | + | 402 | WP_024140008.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| N7918_RS29065 (N7918_29065) | 69154..70164 | + | 1011 | WP_262191642.1 | aldo/keto reductase | - |
| N7918_RS29070 (N7918_29070) | 70263..70850 | - | 588 | WP_262191649.1 | cysteine/O-acetylserine transporter | - |
| N7918_RS29075 (N7918_29075) | 70954..71832 | + | 879 | WP_262191644.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..168116 | 168116 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17708.47 Da Isoelectric Point: 9.8719
>T259602 WP_262191639.1 NZ_CP106659:c66605-66120 [Klebsiella michiganensis]
VGHVTAPEPLSAFHQVAEFVSGETVLDDWLKQKGLKNQSLGAARTFVVCKKDTKQIAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
VGHVTAPEPLSAFHQVAEFVSGETVLDDWLKQKGLKNQSLGAARTFVVCKKDTKQIAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSLRGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQPRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|