Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 5326781..5327553 | Replicon | chromosome |
Accession | NZ_CP106658 | ||
Organism | Klebsiella michiganensis strain 8BG |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | N7918_RS25220 | Protein ID | WP_047935068.1 |
Coordinates | 5326781..5327170 (-) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | N7918_RS25225 | Protein ID | WP_171820356.1 |
Coordinates | 5327227..5327553 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7918_RS25195 (N7918_25195) | 5323077..5323445 | - | 369 | WP_224255022.1 | hypothetical protein | - |
N7918_RS25200 (N7918_25200) | 5323842..5324441 | - | 600 | WP_257393814.1 | transcriptional regulator | - |
N7918_RS25205 (N7918_25205) | 5324534..5325502 | + | 969 | WP_000654811.1 | IS5 family transposase | - |
N7918_RS25210 (N7918_25210) | 5325558..5325704 | - | 147 | Protein_4955 | helix-turn-helix transcriptional regulator | - |
N7918_RS25215 (N7918_25215) | 5325848..5326693 | - | 846 | WP_047935067.1 | DUF4942 domain-containing protein | - |
N7918_RS25220 (N7918_25220) | 5326781..5327170 | - | 390 | WP_047935068.1 | TA system toxin CbtA family protein | Toxin |
N7918_RS25225 (N7918_25225) | 5327227..5327553 | - | 327 | WP_171820356.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N7918_RS25230 (N7918_25230) | 5327611..5327832 | - | 222 | WP_047724679.1 | DUF987 domain-containing protein | - |
N7918_RS25235 (N7918_25235) | 5327846..5328325 | - | 480 | WP_047935070.1 | DNA repair protein RadC | - |
N7918_RS25240 (N7918_25240) | 5328337..5328786 | - | 450 | WP_262190908.1 | antirestriction protein | - |
N7918_RS25245 (N7918_25245) | 5328819..5329640 | - | 822 | WP_047935072.1 | DUF932 domain-containing protein | - |
N7918_RS25250 (N7918_25250) | 5330724..5330969 | + | 246 | Protein_4963 | IS66 family insertion sequence element accessory protein TnpB | - |
N7918_RS25255 (N7918_25255) | 5331338..5332075 | + | 738 | WP_047935074.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 5314530..5372205 | 57675 | |
- | flank | IS/Tn | - | - | 5324579..5325502 | 923 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 14515.62 Da Isoelectric Point: 9.5224
>T259601 WP_047935068.1 NZ_CP106658:c5327170-5326781 [Klebsiella michiganensis]
MQTKSSPLMREASSRPSPVDVWQALLTCLLAHHYGLTLNDTPFSDEQVIQQHIDAGISLVDALNFIVEKYELVRTDRPGF
SIREQSPFITAIDILRARKATGLMNRGTYKEVTAITRGQYPQARISGKR
MQTKSSPLMREASSRPSPVDVWQALLTCLLAHHYGLTLNDTPFSDEQVIQQHIDAGISLVDALNFIVEKYELVRTDRPGF
SIREQSPFITAIDILRARKATGLMNRGTYKEVTAITRGQYPQARISGKR
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|