Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 5261732..5262308 | Replicon | chromosome |
| Accession | NZ_CP106658 | ||
| Organism | Klebsiella michiganensis strain 8BG | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | N7918_RS24915 | Protein ID | WP_038424021.1 |
| Coordinates | 5262021..5262308 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A0H3H591 |
| Locus tag | N7918_RS24910 | Protein ID | WP_014227757.1 |
| Coordinates | 5261732..5262034 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7918_RS24895 (N7918_24895) | 5258572..5258907 | + | 336 | WP_032719937.1 | endoribonuclease SymE | - |
| N7918_RS24900 (N7918_24900) | 5259359..5260270 | + | 912 | WP_032693024.1 | acetamidase/formamidase family protein | - |
| N7918_RS24905 (N7918_24905) | 5260267..5261610 | + | 1344 | WP_148849614.1 | APC family permease | - |
| N7918_RS24910 (N7918_24910) | 5261732..5262034 | - | 303 | WP_014227757.1 | BrnA antitoxin family protein | Antitoxin |
| N7918_RS24915 (N7918_24915) | 5262021..5262308 | - | 288 | WP_038424021.1 | BrnT family toxin | Toxin |
| N7918_RS24920 (N7918_24920) | 5262559..5263002 | - | 444 | WP_014837312.1 | FosA family fosfomycin resistance glutathione transferase | - |
| N7918_RS24925 (N7918_24925) | 5262996..5263904 | - | 909 | WP_119834582.1 | LysR family transcriptional regulator | - |
| N7918_RS24930 (N7918_24930) | 5263992..5264774 | + | 783 | WP_014837310.1 | NAD(P)H-dependent oxidoreductase | - |
| N7918_RS24935 (N7918_24935) | 5264922..5265506 | + | 585 | WP_004098242.1 | TetR/AcrR family transcriptional regulator | - |
| N7918_RS24940 (N7918_24940) | 5265652..5266452 | + | 801 | WP_046878031.1 | winged helix-turn-helix domain-containing protein | - |
| N7918_RS24945 (N7918_24945) | 5266449..5266967 | + | 519 | WP_042944214.1 | FidL-like protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11253.72 Da Isoelectric Point: 8.5899
>T259600 WP_038424021.1 NZ_CP106658:c5262308-5262021 [Klebsiella michiganensis]
MPMEFEWDANKARSNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTLGLVHGIIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
MPMEFEWDANKARSNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTLGLVHGIIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|