Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-ArgA |
Location | 4803492..4804311 | Replicon | chromosome |
Accession | NZ_CP106658 | ||
Organism | Klebsiella michiganensis strain 8BG |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | J5WT09 |
Locus tag | N7918_RS22840 | Protein ID | WP_004110819.1 |
Coordinates | 4804054..4804311 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | N7918_RS22835 | Protein ID | WP_014837489.1 |
Coordinates | 4803492..4804043 (-) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7918_RS22805 (N7918_22805) | 4799416..4800189 | + | 774 | WP_088168442.1 | Zygote formation protein zyg1 | - |
N7918_RS22810 (N7918_22810) | 4800500..4800973 | + | 474 | WP_032693194.1 | hypothetical protein | - |
N7918_RS22815 (N7918_22815) | 4801242..4801591 | - | 350 | Protein_4490 | type II toxin-antitoxin system VapC family toxin | - |
N7918_RS22820 (N7918_22820) | 4801654..4801812 | - | 159 | Protein_4491 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
N7918_RS22825 (N7918_22825) | 4801846..4802592 | - | 747 | WP_223226754.1 | class I SAM-dependent methyltransferase | - |
N7918_RS22830 (N7918_22830) | 4803016..4803378 | - | 363 | Protein_4493 | class I SAM-dependent methyltransferase | - |
N7918_RS22835 (N7918_22835) | 4803492..4804043 | - | 552 | WP_014837489.1 | N-acetyltransferase | Antitoxin |
N7918_RS22840 (N7918_22840) | 4804054..4804311 | - | 258 | WP_004110819.1 | YjhX family toxin | Toxin |
N7918_RS22845 (N7918_22845) | 4804987..4806171 | + | 1185 | WP_014228054.1 | mannonate dehydratase | - |
N7918_RS22850 (N7918_22850) | 4806245..4807720 | + | 1476 | WP_014228053.1 | fructuronate reductase | - |
N7918_RS22855 (N7918_22855) | 4807859..4808635 | + | 777 | WP_004847986.1 | Uxu operon transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9552.07 Da Isoelectric Point: 11.1381
>T259599 WP_004110819.1 NZ_CP106658:c4804311-4804054 [Klebsiella michiganensis]
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 19902.64 Da Isoelectric Point: 6.4913
>AT259599 WP_014837489.1 NZ_CP106658:c4804043-4803492 [Klebsiella michiganensis]
MTNHSFTFHVASEGDTDDILDVETRAFGYSKEARLVADLLNDESACPTLSLLARHNGEAVGHILFTRATFKGEPDSPMMH
ILAPLAVVPEYQGAGVGGELIRHGIEQLKAMGSQAVFVLGHAAYYPRHGFEPGAGDKGYPAPYPIPAAHKACWMLQPISS
QPLGRTGQIQCARALMKPEHWRE
MTNHSFTFHVASEGDTDDILDVETRAFGYSKEARLVADLLNDESACPTLSLLARHNGEAVGHILFTRATFKGEPDSPMMH
ILAPLAVVPEYQGAGVGGELIRHGIEQLKAMGSQAVFVLGHAAYYPRHGFEPGAGDKGYPAPYPIPAAHKACWMLQPISS
QPLGRTGQIQCARALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|