Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4577880..4578499 Replicon chromosome
Accession NZ_CP106658
Organism Klebsiella michiganensis strain 8BG

Toxin (Protein)


Gene name Hha Uniprot ID H3N9D8
Locus tag N7918_RS21760 Protein ID WP_004099646.1
Coordinates 4578281..4578499 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID H3N7X7
Locus tag N7918_RS21755 Protein ID WP_004129911.1
Coordinates 4577880..4578254 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7918_RS21745 (N7918_21745) 4573037..4574230 + 1194 WP_004136054.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N7918_RS21750 (N7918_21750) 4574253..4577399 + 3147 WP_014228207.1 multidrug efflux RND transporter permease subunit AcrB -
N7918_RS21755 (N7918_21755) 4577880..4578254 + 375 WP_004129911.1 Hha toxicity modulator TomB Antitoxin
N7918_RS21760 (N7918_21760) 4578281..4578499 + 219 WP_004099646.1 HHA domain-containing protein Toxin
N7918_RS21765 (N7918_21765) 4578662..4579228 + 567 WP_038424164.1 maltose O-acetyltransferase -
N7918_RS21770 (N7918_21770) 4579200..4579334 - 135 WP_223226764.1 hypothetical protein -
N7918_RS21775 (N7918_21775) 4579355..4579825 + 471 WP_014228205.1 YlaC family protein -
N7918_RS21780 (N7918_21780) 4579800..4581254 - 1455 WP_014837606.1 PLP-dependent aminotransferase family protein -
N7918_RS21785 (N7918_21785) 4581356..4582054 + 699 WP_262190835.1 GNAT family protein -
N7918_RS21790 (N7918_21790) 4582051..4582191 - 141 WP_003859006.1 type B 50S ribosomal protein L36 -
N7918_RS21795 (N7918_21795) 4582191..4582454 - 264 WP_004848323.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8640.05 Da        Isoelectric Point: 8.9008

>T259598 WP_004099646.1 NZ_CP106658:4578281-4578499 [Klebsiella michiganensis]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14350.09 Da        Isoelectric Point: 4.8989

>AT259598 WP_004129911.1 NZ_CP106658:4577880-4578254 [Klebsiella michiganensis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLITQIDEYL
DDTFVLFSNYGINSADLQKWRKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3H713

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3HD25

References