Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 2091956..2092546 | Replicon | chromosome |
| Accession | NZ_CP106658 | ||
| Organism | Klebsiella michiganensis strain 8BG | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | N7918_RS09990 | Protein ID | WP_088168729.1 |
| Coordinates | 2092214..2092546 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | J6I3K7 |
| Locus tag | N7918_RS09985 | Protein ID | WP_004852307.1 |
| Coordinates | 2091956..2092213 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7918_RS09960 (N7918_09960) | 2087212..2087817 | - | 606 | WP_032720304.1 | glutathione S-transferase family protein | - |
| N7918_RS09965 (N7918_09965) | 2087997..2088923 | + | 927 | WP_014838892.1 | LysR substrate-binding domain-containing protein | - |
| N7918_RS09970 (N7918_09970) | 2088961..2089959 | - | 999 | WP_014229982.1 | aldo/keto reductase | - |
| N7918_RS09975 (N7918_09975) | 2090060..2090974 | + | 915 | WP_262191307.1 | LysR family transcriptional regulator | - |
| N7918_RS09980 (N7918_09980) | 2091165..2091245 | - | 81 | Protein_1958 | molybdopterin-binding protein | - |
| N7918_RS09985 (N7918_09985) | 2091956..2092213 | + | 258 | WP_004852307.1 | antitoxin | Antitoxin |
| N7918_RS09990 (N7918_09990) | 2092214..2092546 | + | 333 | WP_088168729.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| N7918_RS10000 (N7918_10000) | 2092869..2094326 | + | 1458 | WP_014229916.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| N7918_RS10010 (N7918_10010) | 2094689..2095948 | + | 1260 | WP_032720308.1 | integrase arm-type DNA-binding domain-containing protein | - |
| N7918_RS10015 (N7918_10015) | 2096315..2096614 | - | 300 | WP_071785591.1 | microcin E492 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | iroB | 2082250..2117722 | 35472 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11788.74 Da Isoelectric Point: 10.1863
>T259593 WP_088168729.1 NZ_CP106658:2092214-2092546 [Klebsiella michiganensis]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVPLEGAGIKTTGVIRCDQPITI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPITSGGNFARTAGFTVPLEGAGIKTTGVIRCDQPITI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|