Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 955116..955773 | Replicon | chromosome |
| Accession | NZ_CP106658 | ||
| Organism | Klebsiella michiganensis strain 8BG | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | J5U333 |
| Locus tag | N7918_RS04670 | Protein ID | WP_004854060.1 |
| Coordinates | 955363..955773 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | H3N295 |
| Locus tag | N7918_RS04665 | Protein ID | WP_004124953.1 |
| Coordinates | 955116..955382 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7918_RS04650 (N7918_04650) | 950350..950775 | - | 426 | WP_004854067.1 | PTS sugar transporter subunit IIA | - |
| N7918_RS04655 (N7918_04655) | 950896..953694 | - | 2799 | WP_032720094.1 | transcriptional regulator DagR | - |
| N7918_RS04660 (N7918_04660) | 953888..954871 | - | 984 | WP_262191091.1 | tRNA-modifying protein YgfZ | - |
| N7918_RS04665 (N7918_04665) | 955116..955382 | + | 267 | WP_004124953.1 | FAD assembly factor SdhE | Antitoxin |
| N7918_RS04670 (N7918_04670) | 955363..955773 | + | 411 | WP_004854060.1 | protein YgfX | Toxin |
| N7918_RS04675 (N7918_04675) | 955782..956303 | - | 522 | WP_014226792.1 | flavodoxin FldB | - |
| N7918_RS04680 (N7918_04680) | 956425..957321 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
| N7918_RS04685 (N7918_04685) | 957344..958057 | + | 714 | WP_262191092.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N7918_RS04690 (N7918_04690) | 958063..959796 | + | 1734 | WP_262191093.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16106.97 Da Isoelectric Point: 10.9455
>T259592 WP_004854060.1 NZ_CP106658:955363-955773 [Klebsiella michiganensis]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
VVLWQSDLRISWRAQWFSLLMHGVVAALVLLMPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIIGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLLKPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYA5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H3L9 |