Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 794329..795098 | Replicon | chromosome |
Accession | NZ_CP106658 | ||
Organism | Klebsiella michiganensis strain 8BG |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | N7918_RS03840 | Protein ID | WP_114262886.1 |
Coordinates | 794329..794715 (-) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | N7918_RS03845 | Protein ID | WP_171820356.1 |
Coordinates | 794772..795098 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7918_RS03825 (N7918_03825) | 789726..791096 | - | 1371 | WP_014839553.1 | cystathionine beta-synthase | - |
N7918_RS03830 (N7918_03830) | 791642..793030 | + | 1389 | WP_042946044.1 | DASS family sodium-coupled anion symporter | - |
N7918_RS03835 (N7918_03835) | 793882..794242 | - | 361 | Protein_754 | DUF4942 domain-containing protein | - |
N7918_RS03840 (N7918_03840) | 794329..794715 | - | 387 | WP_114262886.1 | TA system toxin CbtA family protein | Toxin |
N7918_RS03845 (N7918_03845) | 794772..795098 | - | 327 | WP_171820356.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N7918_RS03850 (N7918_03850) | 795156..795377 | - | 222 | WP_004192297.1 | DUF987 domain-containing protein | - |
N7918_RS03855 (N7918_03855) | 795391..795870 | - | 480 | WP_257945973.1 | DNA repair protein RadC | - |
N7918_RS03860 (N7918_03860) | 795882..796325 | - | 444 | WP_114262889.1 | antirestriction protein | - |
N7918_RS03865 (N7918_03865) | 796405..796635 | - | 231 | WP_224357616.1 | DUF905 domain-containing protein | - |
N7918_RS03870 (N7918_03870) | 796659..797483 | - | 825 | WP_114262890.1 | DUF932 domain-containing protein | - |
N7918_RS03875 (N7918_03875) | 798006..798638 | + | 633 | WP_072024984.1 | inovirus Gp2 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14405.54 Da Isoelectric Point: 8.0783
>T259591 WP_114262886.1 NZ_CP106658:c794715-794329 [Klebsiella michiganensis]
MQTKLPFMRAASSRPSPVDVWQTLLTCLLEHHYGLTLSDTPFSDEQVIQQHIDAGISLVDALNFIVEKYELVRTDRPGFS
ILTQSPFITPIDILRARKATGLMNRDTYKEVTAITRGQHPQVSAPGKR
MQTKLPFMRAASSRPSPVDVWQTLLTCLLEHHYGLTLSDTPFSDEQVIQQHIDAGISLVDALNFIVEKYELVRTDRPGFS
ILTQSPFITPIDILRARKATGLMNRDTYKEVTAITRGQHPQVSAPGKR
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|