Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 95861..96387 | Replicon | plasmid pKP5076-1 |
| Accession | NZ_CP106655 | ||
| Organism | Klebsiella pneumoniae strain KP5076 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | N7990_RS26485 | Protein ID | WP_000323025.1 |
| Coordinates | 96100..96387 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | N7990_RS26480 | Protein ID | WP_000534858.1 |
| Coordinates | 95861..96100 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7990_RS26460 (N7990_26460) | 92189..93427 | + | 1239 | WP_003030308.1 | IS110 family transposase | - |
| N7990_RS26465 (N7990_26465) | 93903..94475 | + | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
| N7990_RS26470 (N7990_26470) | 94675..95598 | + | 924 | WP_020277922.1 | cation diffusion facilitator family transporter | - |
| N7990_RS26475 (N7990_26475) | 95732..95836 | - | 105 | Protein_104 | hypothetical protein | - |
| N7990_RS26480 (N7990_26480) | 95861..96100 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| N7990_RS26485 (N7990_26485) | 96100..96387 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| N7990_RS26490 (N7990_26490) | 96454..97488 | - | 1035 | Protein_107 | IS481 family transposase | - |
| N7990_RS26495 (N7990_26495) | 97549..97641 | + | 93 | Protein_108 | Hok/Gef family protein | - |
| N7990_RS26500 (N7990_26500) | 97605..97706 | + | 102 | Protein_109 | FlmC family protein | - |
| N7990_RS26505 (N7990_26505) | 97871..98356 | - | 486 | WP_032752057.1 | hypothetical protein | - |
| N7990_RS26510 (N7990_26510) | 98546..98818 | + | 273 | WP_023280873.1 | hypothetical protein | - |
| N7990_RS26515 (N7990_26515) | 98815..99165 | + | 351 | WP_020277938.1 | hypothetical protein | - |
| N7990_RS26520 (N7990_26520) | 99682..100062 | + | 381 | WP_015632488.1 | hypothetical protein | - |
| N7990_RS26525 (N7990_26525) | 100128..100475 | + | 348 | WP_020316654.1 | hypothetical protein | - |
| N7990_RS26530 (N7990_26530) | 100563..100793 | + | 231 | WP_020805755.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | mrkJ / mrkF / mrkD / mrkC / mrkB / mrkA | 1..190782 | 190782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T259588 WP_000323025.1 NZ_CP106655:96100-96387 [Klebsiella pneumoniae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|