Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 39399..39924 Replicon plasmid pKP5076-1
Accession NZ_CP106655
Organism Klebsiella pneumoniae strain KP5076

Toxin (Protein)


Gene name ccdB Uniprot ID A0A7H9GHC5
Locus tag N7990_RS26165 Protein ID WP_009309918.1
Coordinates 39619..39924 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag N7990_RS26160 Protein ID WP_001568025.1
Coordinates 39399..39617 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7990_RS26135 (N7990_26135) 35525..36547 - 1023 WP_000361404.1 helicase UvrD -
N7990_RS26140 (N7990_26140) 36532..38094 - 1563 WP_004206609.1 AAA family ATPase -
N7990_RS26145 (N7990_26145) 38168..38584 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
N7990_RS26150 (N7990_26150) 38581..38811 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
N7990_RS26155 (N7990_26155) 38768..39229 + 462 WP_168443756.1 hypothetical protein -
N7990_RS26160 (N7990_26160) 39399..39617 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
N7990_RS26165 (N7990_26165) 39619..39924 + 306 WP_009309918.1 type II toxin-antitoxin system toxin CcdB Toxin
N7990_RS26170 (N7990_26170) 40153..40293 + 141 WP_162898808.1 hypothetical protein -
N7990_RS26175 (N7990_26175) 40343..40678 + 336 WP_009309920.1 hypothetical protein -
N7990_RS26180 (N7990_26180) 40712..41728 + 1017 WP_009309921.1 hypothetical protein -
N7990_RS26185 (N7990_26185) 41926..42705 + 780 WP_023287113.1 site-specific integrase -
N7990_RS26190 (N7990_26190) 42763..43020 - 258 WP_009310077.1 hypothetical protein -
N7990_RS26195 (N7990_26195) 43149..43262 - 114 WP_014343462.1 hypothetical protein -
N7990_RS26200 (N7990_26200) 43794..44761 - 968 Protein_49 IS5 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - mrkJ / mrkF / mrkD / mrkC / mrkB / mrkA 1..190782 190782


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11571.24 Da        Isoelectric Point: 6.4661

>T259587 WP_009309918.1 NZ_CP106655:39619-39924 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVVPLASARLLSDKVSRELYPVVHIGDDSYRLMTTDMASVTASVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT259587 WP_001568025.1 NZ_CP106655:39399-39617 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7H9GHC5

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References