Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3778..4514 | Replicon | plasmid pKP5076-1 |
| Accession | NZ_CP106655 | ||
| Organism | Klebsiella pneumoniae strain KP5076 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | N7990_RS25975 | Protein ID | WP_003026803.1 |
| Coordinates | 3778..4260 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | N7990_RS25980 | Protein ID | WP_003026799.1 |
| Coordinates | 4248..4514 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7990_RS25960 (N7990_25960) | 603..1307 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| N7990_RS25965 (N7990_25965) | 1513..2145 | + | 633 | WP_001567369.1 | hypothetical protein | - |
| N7990_RS25970 (N7990_25970) | 2174..3577 | - | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| N7990_RS25975 (N7990_25975) | 3778..4260 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| N7990_RS25980 (N7990_25980) | 4248..4514 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| N7990_RS25985 (N7990_25985) | 4759..5193 | - | 435 | WP_001567367.1 | cell envelope integrity protein TolA | - |
| N7990_RS25990 (N7990_25990) | 5240..5788 | - | 549 | WP_001567366.1 | thioredoxin fold domain-containing protein | - |
| N7990_RS25995 (N7990_25995) | 6280..7400 | + | 1121 | WP_087759866.1 | IS3-like element ISKpn34 family transposase | - |
| N7990_RS26000 (N7990_26000) | 7507..7815 | + | 309 | WP_017896554.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | mrkJ / mrkF / mrkD / mrkC / mrkB / mrkA | 1..190782 | 190782 | |
| - | inside | IScluster/Tn | - | - | 603..7400 | 6797 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T259585 WP_003026803.1 NZ_CP106655:c4260-3778 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |