Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4716061..4716577 | Replicon | chromosome |
| Accession | NZ_CP106654 | ||
| Organism | Klebsiella pneumoniae strain KP5076 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | N7990_RS23270 | Protein ID | WP_002886902.1 |
| Coordinates | 4716061..4716345 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | N7990_RS23275 | Protein ID | WP_002886901.1 |
| Coordinates | 4716335..4716577 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7990_RS23245 (4711545) | 4711545..4711808 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| N7990_RS23250 (4711938) | 4711938..4712111 | + | 174 | WP_019725541.1 | hypothetical protein | - |
| N7990_RS23255 (4712114) | 4712114..4712857 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| N7990_RS23260 (4713214) | 4713214..4715352 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| N7990_RS23265 (4715593) | 4715593..4716057 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| N7990_RS23270 (4716061) | 4716061..4716345 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7990_RS23275 (4716335) | 4716335..4716577 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| N7990_RS23280 (4716655) | 4716655..4718565 | - | 1911 | WP_023328821.1 | PRD domain-containing protein | - |
| N7990_RS23285 (4718588) | 4718588..4719742 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| N7990_RS23290 (4719809) | 4719809..4720549 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T259582 WP_002886902.1 NZ_CP106654:c4716345-4716061 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |