Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
Location | 4625589..4626277 | Replicon | chromosome |
Accession | NZ_CP106654 | ||
Organism | Klebsiella pneumoniae strain KP5076 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | N7990_RS22865 | Protein ID | WP_023328858.1 |
Coordinates | 4625589..4625930 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | N7990_RS22870 | Protein ID | WP_023328857.1 |
Coordinates | 4625951..4626277 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7990_RS22835 (4620611) | 4620611..4620877 | + | 267 | WP_004178415.1 | hypothetical protein | - |
N7990_RS22840 (4620877) | 4620877..4621549 | + | 673 | Protein_4475 | DUF4400 domain-containing protein | - |
N7990_RS22845 (4621560) | 4621560..4622444 | + | 885 | WP_004192285.1 | RES domain-containing protein | - |
N7990_RS22850 (4622643) | 4622643..4622831 | - | 189 | Protein_4477 | transposase | - |
N7990_RS22855 (4622848) | 4622848..4623959 | - | 1112 | Protein_4478 | IS3 family transposase | - |
N7990_RS22860 (4624327) | 4624327..4625334 | - | 1008 | WP_023328859.1 | restriction endonuclease | - |
N7990_RS22865 (4625589) | 4625589..4625930 | - | 342 | WP_023328858.1 | TA system toxin CbtA family protein | Toxin |
N7990_RS22870 (4625951) | 4625951..4626277 | - | 327 | WP_023328857.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N7990_RS22875 (4626291) | 4626291..4626767 | - | 477 | WP_262287978.1 | DNA repair protein RadC | - |
N7990_RS22880 (4626778) | 4626778..4627218 | - | 441 | WP_023328855.1 | antirestriction protein | - |
N7990_RS22885 (4627288) | 4627288..4627518 | - | 231 | WP_023328854.1 | DUF905 domain-containing protein | - |
N7990_RS22890 (4627542) | 4627542..4628369 | - | 828 | WP_032430976.1 | DUF932 domain-containing protein | - |
N7990_RS22895 (4628465) | 4628465..4629142 | - | 678 | WP_023328852.1 | hypothetical protein | - |
N7990_RS22900 (4629428) | 4629428..4630321 | - | 894 | WP_023328851.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4614722..4659495 | 44773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12806.78 Da Isoelectric Point: 9.8952
>T259581 WP_023328858.1 NZ_CP106654:c4625930-4625589 [Klebsiella pneumoniae]
MKTLPATTPQAAKLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAR
MKTLPATTPQAAKLYLSPVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRRGF
NWQEQSPYLRAVDILRARQATGLLKRNRISAAR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|