Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3986690..3987309 Replicon chromosome
Accession NZ_CP106654
Organism Klebsiella pneumoniae strain KP5076

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag N7990_RS19775 Protein ID WP_002892050.1
Coordinates 3987091..3987309 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag N7990_RS19770 Protein ID WP_002892066.1
Coordinates 3986690..3987064 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7990_RS19760 (3981842) 3981842..3983035 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
N7990_RS19765 (3983058) 3983058..3986204 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
N7990_RS19770 (3986690) 3986690..3987064 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
N7990_RS19775 (3987091) 3987091..3987309 + 219 WP_002892050.1 HHA domain-containing protein Toxin
N7990_RS19780 (3987472) 3987472..3988038 + 567 WP_002892030.1 maltose O-acetyltransferase -
N7990_RS19785 (3988010) 3988010..3988150 - 141 WP_004147370.1 hypothetical protein -
N7990_RS19790 (3988171) 3988171..3988641 + 471 WP_002892026.1 YlaC family protein -
N7990_RS19795 (3988616) 3988616..3990067 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
N7990_RS19800 (3990168) 3990168..3990866 + 699 WP_002892021.1 GNAT family protein -
N7990_RS19805 (3990863) 3990863..3991003 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
N7990_RS19810 (3991003) 3991003..3991266 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T259579 WP_002892050.1 NZ_CP106654:3987091-3987309 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT259579 WP_002892066.1 NZ_CP106654:3986690-3987064 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References