Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 525914..526550 | Replicon | chromosome |
| Accession | NZ_CP106652 | ||
| Organism | Bacillus safensis strain 33.4 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A0P7G713 |
| Locus tag | N7921_RS02545 | Protein ID | WP_024425388.1 |
| Coordinates | 526200..526550 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | W8QJ31 |
| Locus tag | N7921_RS02540 | Protein ID | WP_003214273.1 |
| Coordinates | 525914..526195 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7921_RS02520 (N7921_02520) | 522072..522677 | - | 606 | WP_144472946.1 | rhomboid family intramembrane serine protease | - |
| N7921_RS02525 (N7921_02525) | 522772..523137 | + | 366 | WP_047202005.1 | holo-ACP synthase | - |
| N7921_RS02530 (N7921_02530) | 523298..524314 | + | 1017 | WP_095407802.1 | outer membrane lipoprotein carrier protein LolA | - |
| N7921_RS02535 (N7921_02535) | 524454..525620 | + | 1167 | WP_263639938.1 | alanine racemase | - |
| N7921_RS02540 (N7921_02540) | 525914..526195 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
| N7921_RS02545 (N7921_02545) | 526200..526550 | + | 351 | WP_024425388.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| N7921_RS02550 (N7921_02550) | 526668..527498 | + | 831 | WP_024427375.1 | RsbT co-antagonist protein RsbRA | - |
| N7921_RS02555 (N7921_02555) | 527503..527871 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
| N7921_RS02560 (N7921_02560) | 527874..528275 | + | 402 | WP_024427376.1 | anti-sigma regulatory factor | - |
| N7921_RS02565 (N7921_02565) | 528286..529293 | + | 1008 | WP_095407804.1 | PP2C family protein-serine/threonine phosphatase | - |
| N7921_RS02570 (N7921_02570) | 529353..529682 | + | 330 | WP_017358393.1 | anti-sigma factor antagonist | - |
| N7921_RS02575 (N7921_02575) | 529679..530167 | + | 489 | WP_048240335.1 | anti-sigma B factor RsbW | - |
| N7921_RS02580 (N7921_02580) | 530133..530921 | + | 789 | WP_024427378.1 | RNA polymerase sigma factor SigB | - |
| N7921_RS02585 (N7921_02585) | 530921..531520 | + | 600 | WP_095407805.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8891
>T259569 WP_024425388.1 NZ_CP106652:526200-526550 [Bacillus safensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P7G713 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A081L854 |