Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 4272472..4273067 Replicon chromosome
Accession NZ_CP104992
Organism Rhizobium sp. CC-CFT758

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag N7E02_RS29115 Protein ID WP_286581321.1
Coordinates 4272472..4272660 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag N7E02_RS29120 Protein ID WP_286581322.1
Coordinates 4272663..4273067 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7E02_RS29095 (N7E02_29095) 4268434..4269400 + 967 Protein_4165 quinone oxidoreductase -
N7E02_RS29100 (N7E02_29100) 4269532..4270676 + 1145 Protein_4166 alpha-hydroxy acid oxidase -
N7E02_RS29105 (N7E02_29105) 4270699..4271592 + 894 WP_286581319.1 TIGR03571 family LLM class oxidoreductase -
N7E02_RS29110 (N7E02_29110) 4271599..4272360 - 762 WP_286581320.1 hypothetical protein -
N7E02_RS29115 (N7E02_29115) 4272472..4272660 + 189 WP_286581321.1 type II toxin-antitoxin system HicA family toxin Toxin
N7E02_RS29120 (N7E02_29120) 4272663..4273067 + 405 WP_286581322.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N7E02_RS29125 (N7E02_29125) 4273068..4273829 - 762 WP_286581323.1 metallophosphoesterase family protein -
N7E02_RS29130 (N7E02_29130) 4273829..4274185 - 357 WP_286581324.1 hydroxyisourate hydrolase -
N7E02_RS29135 (N7E02_29135) 4274182..4274676 - 495 WP_286584092.1 ureidoglycolate lyase -
N7E02_RS29140 (N7E02_29140) 4274691..4274822 - 132 WP_286581325.1 hypothetical protein -
N7E02_RS29145 (N7E02_29145) 4274824..4275063 - 240 WP_286581326.1 hypothetical protein -
N7E02_RS29150 (N7E02_29150) 4275065..4275562 - 498 WP_286581327.1 2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase -
N7E02_RS29155 (N7E02_29155) 4275559..4276503 - 945 WP_286581328.1 allantoinase PuuE -
N7E02_RS29160 (N7E02_29160) 4276581..4276793 - 213 WP_286581329.1 hypothetical protein -
N7E02_RS29165 (N7E02_29165) 4276808..4277761 - 954 WP_286581330.1 homocysteine S-methyltransferase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-124)


Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 6969.14 Da        Isoelectric Point: 11.9102

>T259568 WP_286581321.1 NZ_CP104992:4272472-4272660 [Rhizobium sp. CC-CFT758]
MKSGDVIARLRGDGWFEVAQRGSHIQFKHPTKPGRVTVPHPKRDIPIGTLRSIEKQAGLKLR

Download         Length: 189 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14395.05 Da        Isoelectric Point: 4.2513

>AT259568 WP_286581322.1 NZ_CP104992:4272663-4273067 [Rhizobium sp. CC-CFT758]
MSNYIGLIHKDADSDYGVSFPDFPGIVTAGTTLDEARQMAEEALAFHVDGMIEDGDAVPEPSSLENVMADETNRDGVAIL
VTLKTQTTKVVRVNITLPEDVLQTIDAYAEANGLSRSGFLARAARHEIKRSSAA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References