Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | stbE-relB/ParE(toxin) |
Location | 4266553..4266952 | Replicon | chromosome |
Accession | NZ_CP104992 | ||
Organism | Rhizobium sp. CC-CFT758 |
Toxin (Protein)
Gene name | stbE | Uniprot ID | - |
Locus tag | N7E02_RS29080 | Protein ID | WP_286581316.1 |
Coordinates | 4266553..4266834 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N7E02_RS29085 | Protein ID | WP_286581317.1 |
Coordinates | 4266824..4266952 (-) | Length | 43 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E02_RS29060 (N7E02_29060) | 4261969..4262868 | + | 900 | WP_286581314.1 | AraC family transcriptional regulator | - |
N7E02_RS29065 (N7E02_29065) | 4263029..4263787 | + | 759 | WP_286581315.1 | SDR family oxidoreductase | - |
N7E02_RS29070 (N7E02_29070) | 4263969..4265197 | + | 1229 | Protein_4160 | urate hydroxylase PuuD | - |
N7E02_RS29075 (N7E02_29075) | 4265235..4266556 | + | 1322 | Protein_4161 | guanine deaminase | - |
N7E02_RS29080 (N7E02_29080) | 4266553..4266834 | - | 282 | WP_286581316.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7E02_RS29085 (N7E02_29085) | 4266824..4266952 | - | 129 | WP_286581317.1 | prevent-host-death protein | Antitoxin |
N7E02_RS29090 (N7E02_29090) | 4267351..4268295 | + | 945 | WP_286581318.1 | MYG1 family protein | - |
N7E02_RS29095 (N7E02_29095) | 4268434..4269400 | + | 967 | Protein_4165 | quinone oxidoreductase | - |
N7E02_RS29100 (N7E02_29100) | 4269532..4270676 | + | 1145 | Protein_4166 | alpha-hydroxy acid oxidase | - |
N7E02_RS29105 (N7E02_29105) | 4270699..4271592 | + | 894 | WP_286581319.1 | TIGR03571 family LLM class oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11045.87 Da Isoelectric Point: 10.8061
>T259567 WP_286581316.1 NZ_CP104992:c4266834-4266553 [Rhizobium sp. CC-CFT758]
MSYRLEFLPSARKEWDKLGATLREQFRKKLAERLLNPRVPPDALRGMADHYKIKLRTAGYRLVYRVEDERVTVVVIAVGK
RERSEVYEIARNR
MSYRLEFLPSARKEWDKLGATLREQFRKKLAERLLNPRVPPDALRGMADHYKIKLRTAGYRLVYRVEDERVTVVVIAVGK
RERSEVYEIARNR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|