Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/DUF433(antitoxin) |
Location | 3288500..3289053 | Replicon | chromosome |
Accession | NZ_CP104992 | ||
Organism | Rhizobium sp. CC-CFT758 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | N7E02_RS24125 | Protein ID | WP_286580116.1 |
Coordinates | 3288721..3289053 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | N7E02_RS24120 | Protein ID | WP_286580114.1 |
Coordinates | 3288500..3288724 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E02_RS24090 (N7E02_24090) | 3283671..3284318 | - | 648 | WP_286580105.1 | protein-methionine-sulfoxide reductase heme-binding subunit MsrQ | - |
N7E02_RS24095 (N7E02_24095) | 3284321..3285265 | - | 945 | WP_286580106.1 | protein-methionine-sulfoxide reductase catalytic subunit MsrP | - |
N7E02_RS24100 (N7E02_24100) | 3285477..3285899 | + | 423 | WP_286580108.1 | DUF4112 domain-containing protein | - |
N7E02_RS24105 (N7E02_24105) | 3285902..3286096 | - | 195 | WP_286580109.1 | type II toxin-antitoxin system HicA family toxin | - |
N7E02_RS24110 (N7E02_24110) | 3286099..3286572 | - | 474 | WP_286580111.1 | DUF1902 domain-containing protein | - |
N7E02_RS24115 (N7E02_24115) | 3286571..3288406 | + | 1836 | WP_286580112.1 | dihydroxy-acid dehydratase | - |
N7E02_RS24120 (N7E02_24120) | 3288500..3288724 | + | 225 | WP_286580114.1 | DUF433 domain-containing protein | Antitoxin |
N7E02_RS24125 (N7E02_24125) | 3288721..3289053 | + | 333 | WP_286580116.1 | DUF5615 family PIN-like protein | Toxin |
N7E02_RS24130 (N7E02_24130) | 3289084..3289449 | - | 366 | WP_286580117.1 | hypothetical protein | - |
N7E02_RS24135 (N7E02_24135) | 3289494..3289868 | - | 375 | WP_286584007.1 | DUF1232 domain-containing protein | - |
N7E02_RS24140 (N7E02_24140) | 3289997..3291400 | + | 1404 | WP_286580119.1 | DegQ family serine endoprotease | - |
N7E02_RS24145 (N7E02_24145) | 3291397..3292709 | + | 1313 | Protein_3191 | replication-associated recombination protein A | - |
N7E02_RS24150 (N7E02_24150) | 3292713..3293027 | - | 315 | WP_286580120.1 | DUF1883 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12597.36 Da Isoelectric Point: 4.5642
>T259566 WP_286580116.1 NZ_CP104992:3288721-3289053 [Rhizobium sp. CC-CFT758]
MMRFLVDAQLPPALARWLVDQGHEAGHVVDFNLQSAADREIWDFAVQRDAVIITKDEDFAQRRALTKDGPTIVWVRLPNS
RRSDLLQWFEKALDDIVAALERGETIVEVI
MMRFLVDAQLPPALARWLVDQGHEAGHVVDFNLQSAADREIWDFAVQRDAVIITKDEDFAQRRALTKDGPTIVWVRLPNS
RRSDLLQWFEKALDDIVAALERGETIVEVI
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|