Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/DUF433(antitoxin)
Location 3288500..3289053 Replicon chromosome
Accession NZ_CP104992
Organism Rhizobium sp. CC-CFT758

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag N7E02_RS24125 Protein ID WP_286580116.1
Coordinates 3288721..3289053 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag N7E02_RS24120 Protein ID WP_286580114.1
Coordinates 3288500..3288724 (+) Length 75 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7E02_RS24090 (N7E02_24090) 3283671..3284318 - 648 WP_286580105.1 protein-methionine-sulfoxide reductase heme-binding subunit MsrQ -
N7E02_RS24095 (N7E02_24095) 3284321..3285265 - 945 WP_286580106.1 protein-methionine-sulfoxide reductase catalytic subunit MsrP -
N7E02_RS24100 (N7E02_24100) 3285477..3285899 + 423 WP_286580108.1 DUF4112 domain-containing protein -
N7E02_RS24105 (N7E02_24105) 3285902..3286096 - 195 WP_286580109.1 type II toxin-antitoxin system HicA family toxin -
N7E02_RS24110 (N7E02_24110) 3286099..3286572 - 474 WP_286580111.1 DUF1902 domain-containing protein -
N7E02_RS24115 (N7E02_24115) 3286571..3288406 + 1836 WP_286580112.1 dihydroxy-acid dehydratase -
N7E02_RS24120 (N7E02_24120) 3288500..3288724 + 225 WP_286580114.1 DUF433 domain-containing protein Antitoxin
N7E02_RS24125 (N7E02_24125) 3288721..3289053 + 333 WP_286580116.1 DUF5615 family PIN-like protein Toxin
N7E02_RS24130 (N7E02_24130) 3289084..3289449 - 366 WP_286580117.1 hypothetical protein -
N7E02_RS24135 (N7E02_24135) 3289494..3289868 - 375 WP_286584007.1 DUF1232 domain-containing protein -
N7E02_RS24140 (N7E02_24140) 3289997..3291400 + 1404 WP_286580119.1 DegQ family serine endoprotease -
N7E02_RS24145 (N7E02_24145) 3291397..3292709 + 1313 Protein_3191 replication-associated recombination protein A -
N7E02_RS24150 (N7E02_24150) 3292713..3293027 - 315 WP_286580120.1 DUF1883 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Domain of unknown function DUF5615

(2-77)

Antitoxin

Protein of unknown function DUF433

(7-62)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12597.36 Da        Isoelectric Point: 4.5642

>T259566 WP_286580116.1 NZ_CP104992:3288721-3289053 [Rhizobium sp. CC-CFT758]
MMRFLVDAQLPPALARWLVDQGHEAGHVVDFNLQSAADREIWDFAVQRDAVIITKDEDFAQRRALTKDGPTIVWVRLPNS
RRSDLLQWFEKALDDIVAALERGETIVEVI

Download         Length: 333 bp

Antitoxin


Download         Length: 75 a.a.        Molecular weight: 8307.45 Da        Isoelectric Point: 6.0660

>AT259566 WP_286580114.1 NZ_CP104992:3288500-3288724 [Rhizobium sp. CC-CFT758]
MSELHRITFDPHVSSGRPTIRGMRIRVKDILELLAAGASHEEILEDYPTLEPADIRAALEYAARQSDHTVLRVA

Download         Length: 225 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References