Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 2492210..2492757 | Replicon | chromosome |
| Accession | NZ_CP104992 | ||
| Organism | Rhizobium sp. CC-CFT758 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | N7E02_RS20020 | Protein ID | WP_286579366.1 |
| Coordinates | 2492452..2492757 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | - |
| Locus tag | N7E02_RS20015 | Protein ID | WP_286579365.1 |
| Coordinates | 2492210..2492455 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E02_RS20000 (N7E02_20000) | 2487375..2487925 | + | 551 | Protein_2373 | LemA family protein | - |
| N7E02_RS20005 (N7E02_20005) | 2487940..2489913 | + | 1974 | WP_286579363.1 | DUF2207 domain-containing protein | - |
| N7E02_RS20010 (N7E02_20010) | 2489954..2492107 | + | 2154 | WP_286579364.1 | glycine--tRNA ligase subunit beta | - |
| N7E02_RS20015 (N7E02_20015) | 2492210..2492455 | + | 246 | WP_286579365.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| N7E02_RS20020 (N7E02_20020) | 2492452..2492757 | + | 306 | WP_286579366.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7E02_RS20025 (N7E02_20025) | 2492754..2493245 | + | 492 | WP_286579367.1 | DUF523 domain-containing protein | - |
| N7E02_RS20030 (N7E02_20030) | 2493414..2495246 | - | 1833 | WP_286579368.1 | methyl-accepting chemotaxis protein | - |
| N7E02_RS20035 (N7E02_20035) | 2495517..2495993 | - | 477 | WP_286579369.1 | plant virulence effector HPE1-like domain-containing protein | - |
| N7E02_RS20040 (N7E02_20040) | 2496106..2497377 | - | 1272 | WP_286579370.1 | phosphoribosylamine--glycine ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11990.49 Da Isoelectric Point: 6.8700
>T259563 WP_286579366.1 NZ_CP104992:2492452-2492757 [Rhizobium sp. CC-CFT758]
MKVYRLSPAAEADLDDIWNYTIINWSQEQAERYVSRLFDSFIKLGENPSLGRNANWIMSGYRRFRCGHHLIFYVTADDGQ
ANIVRILHEKVDVRRHFDDKE
MKVYRLSPAAEADLDDIWNYTIINWSQEQAERYVSRLFDSFIKLGENPSLGRNANWIMSGYRRFRCGHHLIFYVTADDGQ
ANIVRILHEKVDVRRHFDDKE
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|