Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pasABC/RelE-HTH |
| Location | 2420268..2420751 | Replicon | chromosome |
| Accession | NZ_CP104992 | ||
| Organism | Rhizobium sp. CC-CFT758 | ||
Toxin (Protein)
| Gene name | pasB | Uniprot ID | - |
| Locus tag | N7E02_RS19630 | Protein ID | WP_286579306.1 |
| Coordinates | 2420268..2420537 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | - |
| Locus tag | N7E02_RS19635 | Protein ID | WP_286579307.1 |
| Coordinates | 2420521..2420751 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E02_RS19600 (N7E02_19600) | 2415671..2416516 | - | 846 | WP_286579300.1 | L,D-transpeptidase | - |
| N7E02_RS19605 (N7E02_19605) | 2416747..2417370 | + | 624 | WP_286579301.1 | DNA-3-methyladenine glycosylase I | - |
| N7E02_RS19610 (N7E02_19610) | 2417425..2418135 | - | 711 | WP_286579302.1 | HAD family hydrolase | - |
| N7E02_RS19615 (N7E02_19615) | 2418396..2418770 | - | 375 | WP_286579303.1 | DUF305 domain-containing protein | - |
| N7E02_RS19620 (N7E02_19620) | 2418822..2419283 | - | 462 | WP_286579304.1 | hypothetical protein | - |
| N7E02_RS19625 (N7E02_19625) | 2419512..2420264 | - | 753 | WP_286579305.1 | hypothetical protein | - |
| N7E02_RS19630 (N7E02_19630) | 2420268..2420537 | - | 270 | WP_286579306.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N7E02_RS19635 (N7E02_19635) | 2420521..2420751 | - | 231 | WP_286579307.1 | DUF6290 family protein | Antitoxin |
| N7E02_RS19640 (N7E02_19640) | 2420886..2422441 | + | 1556 | Protein_2301 | histidine--tRNA ligase | - |
| N7E02_RS19645 (N7E02_19645) | 2422660..2423769 | + | 1110 | WP_286579308.1 | ATP phosphoribosyltransferase regulatory subunit | - |
| N7E02_RS19650 (N7E02_19650) | 2423769..2424465 | + | 697 | Protein_2303 | ATP phosphoribosyltransferase | - |
| N7E02_RS19655 (N7E02_19655) | 2424483..2425091 | + | 609 | WP_286579309.1 | methyltransferase domain-containing protein | - |
| N7E02_RS19660 (N7E02_19660) | 2425171..2425620 | - | 450 | WP_286579310.1 | DoxX family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10725.50 Da Isoelectric Point: 10.5786
>T259562 WP_286579306.1 NZ_CP104992:c2420537-2420268 [Rhizobium sp. CC-CFT758]
MAWKIDFQATAIKQLKKMGHNESARIRDFLHTRVKPLDNPRQLGEALQGPRFKHLWRYKVGDYRIICDIQDERLVVLVVE
VDHRRQIYR
MAWKIDFQATAIKQLKKMGHNESARIRDFLHTRVKPLDNPRQLGEALQGPRFKHLWRYKVGDYRIICDIQDERLVVLVVE
VDHRRQIYR
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|