Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 1056100..1056641 | Replicon | chromosome |
Accession | NZ_CP104992 | ||
Organism | Rhizobium sp. CC-CFT758 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | N7E02_RS13185 | Protein ID | WP_286582403.1 |
Coordinates | 1056100..1056393 (-) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | N7E02_RS13190 | Protein ID | WP_286582405.1 |
Coordinates | 1056390..1056641 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N7E02_RS13170 (N7E02_13165) | 1053011..1053505 | + | 495 | WP_286582401.1 | MarR family transcriptional regulator | - |
N7E02_RS13175 (N7E02_13170) | 1053528..1054703 | + | 1176 | WP_286583806.1 | multidrug effflux MFS transporter | - |
N7E02_RS13180 (N7E02_13175) | 1054762..1055985 | - | 1224 | WP_286582402.1 | argininosuccinate synthase | - |
N7E02_RS13185 (N7E02_13180) | 1056100..1056393 | - | 294 | WP_286582403.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N7E02_RS13190 (N7E02_13185) | 1056390..1056641 | - | 252 | WP_286582405.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
N7E02_RS13195 (N7E02_13190) | 1056755..1057612 | + | 858 | WP_286582407.1 | SDR family NAD(P)-dependent oxidoreductase | - |
N7E02_RS13200 (N7E02_13195) | 1057684..1058325 | + | 642 | WP_286582408.1 | LysE family translocator | - |
N7E02_RS13205 (N7E02_13200) | 1058355..1059590 | - | 1236 | WP_286582409.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
N7E02_RS13210 (N7E02_13205) | 1059831..1060334 | - | 504 | WP_286582410.1 | invasion associated locus B family protein | - |
N7E02_RS13215 (N7E02_13210) | 1060655..1061213 | + | 559 | Protein_1041 | sigma-70 family RNA polymerase sigma factor | - |
N7E02_RS13220 (N7E02_13215) | 1061221..1061625 | - | 405 | WP_286582412.1 | YkvA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11610.33 Da Isoelectric Point: 8.4984
>T259561 WP_286582403.1 NZ_CP104992:c1056393-1056100 [Rhizobium sp. CC-CFT758]
MKALVFSPKAEADIDDIYDYTEQHWGFENAEVYTFELRDACRSLVEGPRHGRKIGDEIRRNYFVLSCKAHFIIYRETVSR
IVIVRILHQRMNVRRHL
MKALVFSPKAEADIDDIYDYTEQHWGFENAEVYTFELRDACRSLVEGPRHGRKIGDEIRRNYFVLSCKAHFIIYRETVSR
IVIVRILHQRMNVRRHL
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|