Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 299690..300267 | Replicon | chromosome |
| Accession | NZ_CP104992 | ||
| Organism | Rhizobium sp. CC-CFT758 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | N7E02_RS09555 | Protein ID | WP_286581654.1 |
| Coordinates | 299690..300028 (-) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | N7E02_RS09560 | Protein ID | WP_286581656.1 |
| Coordinates | 300025..300267 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N7E02_RS09540 (N7E02_09540) | 296583..297636 | + | 1054 | Protein_315 | low specificity L-threonine aldolase | - |
| N7E02_RS09545 (N7E02_09545) | 297641..298495 | - | 855 | WP_286581651.1 | LysR family transcriptional regulator | - |
| N7E02_RS09550 (N7E02_09550) | 298686..299684 | + | 999 | WP_286581653.1 | bile acid:sodium symporter family protein | - |
| N7E02_RS09555 (N7E02_09555) | 299690..300028 | - | 339 | WP_286581654.1 | endoribonuclease MazF | Toxin |
| N7E02_RS09560 (N7E02_09560) | 300025..300267 | - | 243 | WP_286581656.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| N7E02_RS09565 (N7E02_09565) | 300408..300889 | - | 482 | Protein_320 | Hsp20 family protein | - |
| N7E02_RS09570 (N7E02_09570) | 301194..302357 | + | 1164 | WP_286581657.1 | hypothetical protein | - |
| N7E02_RS09575 (N7E02_09575) | 302597..303580 | - | 984 | WP_286581658.1 | AraC family transcriptional regulator | - |
| N7E02_RS09580 (N7E02_09580) | 303764..304654 | + | 891 | WP_286581659.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 12069.84 Da Isoelectric Point: 9.6283
>T259560 WP_286581654.1 NZ_CP104992:c300028-299690 [Rhizobium sp. CC-CFT758]
VSAEEYVPQAGDIVWLDFSPQVGHEQAGRRPAVVLSPVAYNRFGLMLCCPLTTKVKGYPFEVTIEGGRGGVVLADQVKSL
DWKARNAQRKGAVSSSELSQIRAKSSALIGRP
VSAEEYVPQAGDIVWLDFSPQVGHEQAGRRPAVVLSPVAYNRFGLMLCCPLTTKVKGYPFEVTIEGGRGGVVLADQVKSL
DWKARNAQRKGAVSSSELSQIRAKSSALIGRP
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|