Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/CC2985(antitoxin)
Location 144298..144845 Replicon plasmid unnamed1
Accession NZ_CP104991
Organism Rhizobium sp. CC-CFT758

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag N7E02_RS04435 Protein ID WP_286578867.1
Coordinates 144298..144591 (-) Length 98 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag N7E02_RS04440 Protein ID WP_286578868.1
Coordinates 144591..144845 (-) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7E02_RS04415 (N7E02_04415) 139688..140704 + 1017 WP_286578863.1 xanthine dehydrogenase family protein subunit M -
N7E02_RS04420 (N7E02_04420) 140826..142973 + 2148 WP_286578864.1 xanthine dehydrogenase family protein molybdopterin-binding subunit -
N7E02_RS04425 (N7E02_04425) 142985..143269 - 285 WP_286578865.1 hypothetical protein -
N7E02_RS04430 (N7E02_04430) 143368..144114 + 747 WP_286578866.1 hypothetical protein -
N7E02_RS04435 (N7E02_04435) 144298..144591 - 294 WP_286578867.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
N7E02_RS04440 (N7E02_04440) 144591..144845 - 255 WP_286578868.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
N7E02_RS04445 (N7E02_04445) 145054..145167 - 114 Protein_159 GntR family transcriptional regulator -
N7E02_RS04450 (N7E02_04450) 145146..145412 - 267 WP_286578869.1 hypothetical protein -
N7E02_RS04455 (N7E02_04455) 145640..146137 - 498 WP_286578870.1 GNAT family N-acetyltransferase -
N7E02_RS04460 (N7E02_04460) 146134..146430 - 297 WP_286578871.1 DUF1778 domain-containing protein -
N7E02_RS04465 (N7E02_04465) 146593..147042 - 450 WP_286578872.1 type II toxin-antitoxin system VapC family toxin -
N7E02_RS04470 (N7E02_04470) 147039..147209 - 171 Protein_164 type II toxin-antitoxin system prevent-host-death family antitoxin -
N7E02_RS04475 (N7E02_04475) 147882..149108 - 1227 WP_286578873.1 GGDEF domain-containing protein -
N7E02_RS04480 (N7E02_04480) 149390..149656 + 267 WP_286578874.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - htpB 1..806102 806102


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Antitoxin ParD

(3-70)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 10993.52 Da        Isoelectric Point: 5.5188

>T259558 WP_286578867.1 NZ_CP104991:c144591-144298 [Rhizobium sp. CC-CFT758]
MPFSLSAQAEEDIVSIAEEGIHVFGAFVAKRYHDELFALFELIAANPRMARGRDEISPPVRIHPFKAHLVVYRLIEDGGV
FVIRIRNSHEDWAGDSF

Download         Length: 294 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9463.54 Da        Isoelectric Point: 8.5775

>AT259558 WP_286578868.1 NZ_CP104991:c144845-144591 [Rhizobium sp. CC-CFT758]
MATMNVSLPDPMKDWVEAQAKTGRYSNVSDYVRDLIRRDQTRTDKIAEMQRFVDDGIASGVGNRSGDQLFAEATARADVN
RRRA

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References