Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 3606896..3607545 Replicon chromosome
Accession NZ_CP104986
Organism Proteus mirabilis strain W47

Toxin (Protein)


Gene name vagD Uniprot ID B4EZB9
Locus tag N7F34_RS16435 Protein ID WP_012368534.1
Coordinates 3606896..3607315 (-) Length 140 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B4EZC0
Locus tag N7F34_RS16440 Protein ID WP_012368535.1
Coordinates 3607312..3607545 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N7F34_RS16405 3602175..3603053 - 879 WP_017628653.1 23S rRNA pseudouridine(2604) synthase RluF -
N7F34_RS16410 3603229..3604143 - 915 WP_262302672.1 fatty acid biosynthesis protein FabY -
N7F34_RS16415 3604167..3604604 - 438 WP_004246810.1 D-aminoacyl-tRNA deacylase -
N7F34_RS16420 3604685..3605302 - 618 WP_004246809.1 glucose-1-phosphatase -
N7F34_RS16425 3605954..3606370 - 417 WP_046334846.1 hypothetical protein -
N7F34_RS16430 3606348..3606671 - 324 WP_104731870.1 hypothetical protein -
N7F34_RS16435 3606896..3607315 - 420 WP_012368534.1 type II toxin-antitoxin system VapC family toxin Toxin
N7F34_RS16440 3607312..3607545 - 234 WP_012368535.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N7F34_RS16445 3607812..3607964 + 153 WP_172764486.1 hypothetical protein -
N7F34_RS16450 3608924..3610132 + 1209 WP_060555750.1 DUF262 domain-containing protein -
N7F34_RS16455 3610349..3610570 - 222 WP_060555751.1 hypothetical protein -
N7F34_RS16460 3610618..3610905 + 288 WP_104731871.1 transposase -
N7F34_RS16465 3611355..3611834 + 480 WP_060555753.1 Hcp family type VI secretion system effector -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(9-56)


Sequences

Toxin        


Download         Length: 140 a.a.        Molecular weight: 15371.88 Da        Isoelectric Point: 7.7288

>T259556 WP_012368534.1 NZ_CP104986:c3607315-3606896 [Proteus mirabilis]
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV

Download         Length: 420 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8890.06 Da        Isoelectric Point: 4.4870

>AT259556 WP_012368535.1 NZ_CP104986:c3607545-3607312 [Proteus mirabilis]
MRTRTVAVFKNGSNRAIRLPKDFDFDGVNELEISRDGDCIILRPVKPNWISLQNEEKADSDFLLERDDVIEEGRVIL

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB B4EZB9

Antitoxin

Source ID Structure
AlphaFold DB B4EZC0

References