Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 4123760..4124554 | Replicon | chromosome |
| Accession | NZ_CP104976 | ||
| Organism | Enterobacter sp. 155105 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | N8O08_RS19990 | Protein ID | WP_194400898.1 |
| Coordinates | 4124033..4124554 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A156QBZ1 |
| Locus tag | N8O08_RS19985 | Protein ID | WP_063143245.1 |
| Coordinates | 4123760..4124029 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8O08_RS19960 (N8O08_19960) | 4119279..4120550 | + | 1272 | WP_223562320.1 | DUF445 domain-containing protein | - |
| N8O08_RS19965 (N8O08_19965) | 4120547..4121623 | - | 1077 | WP_223562319.1 | DUF2955 domain-containing protein | - |
| N8O08_RS19970 (N8O08_19970) | 4121613..4122680 | - | 1068 | WP_223563444.1 | HlyD family secretion protein | - |
| N8O08_RS19975 (N8O08_19975) | 4122677..4123147 | - | 471 | WP_194400897.1 | MarR family transcriptional regulator | - |
| N8O08_RS19980 (N8O08_19980) | 4123398..4123517 | - | 120 | Protein_3909 | transcriptional regulator | - |
| N8O08_RS19985 (N8O08_19985) | 4123760..4124029 | + | 270 | WP_063143245.1 | DUF1778 domain-containing protein | Antitoxin |
| N8O08_RS19990 (N8O08_19990) | 4124033..4124554 | + | 522 | WP_194400898.1 | GNAT family N-acetyltransferase | Toxin |
| N8O08_RS19995 (N8O08_19995) | 4124605..4126020 | - | 1416 | WP_223562318.1 | aldehyde dehydrogenase family protein | - |
| N8O08_RS20000 (N8O08_20000) | 4126121..4127023 | + | 903 | WP_223562317.1 | LysR family transcriptional regulator | - |
| N8O08_RS20005 (N8O08_20005) | 4127010..4127489 | - | 480 | WP_014882392.1 | carboxymuconolactone decarboxylase family protein | - |
| N8O08_RS20010 (N8O08_20010) | 4127593..4128981 | + | 1389 | WP_223562316.1 | PLP-dependent aminotransferase family protein | - |
| N8O08_RS20015 (N8O08_20015) | 4129021..4129182 | - | 162 | WP_032645487.1 | DUF1127 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19790.88 Da Isoelectric Point: 8.4279
>T259554 WP_194400898.1 NZ_CP104976:4124033-4124554 [Enterobacter sp. 155105]
VNDVKIGIFSEDVEYDLSQFDCGEESLNTFLAEHLKRQHRGKFLRGYVLTTREPKPRILGYYTLSGSCFEKAYLPSKTQQ
KRIPYKNVPSVTLGRLAIDKRIQGQGYGELLVIHAMKTVYLASFAVGIHGLFVEALNHKAKEFYLKMGFIPLLAENEFTL
FLPTKTFESVFEE
VNDVKIGIFSEDVEYDLSQFDCGEESLNTFLAEHLKRQHRGKFLRGYVLTTREPKPRILGYYTLSGSCFEKAYLPSKTQQ
KRIPYKNVPSVTLGRLAIDKRIQGQGYGELLVIHAMKTVYLASFAVGIHGLFVEALNHKAKEFYLKMGFIPLLAENEFTL
FLPTKTFESVFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|