Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3618773..3619393 | Replicon | chromosome |
| Accession | NZ_CP104976 | ||
| Organism | Enterobacter sp. 155105 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | - |
| Locus tag | N8O08_RS17460 | Protein ID | WP_148244022.1 |
| Coordinates | 3619175..3619393 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V3PBI9 |
| Locus tag | N8O08_RS17455 | Protein ID | WP_008499288.1 |
| Coordinates | 3618773..3619147 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8O08_RS17445 (N8O08_17445) | 3613900..3615093 | + | 1194 | WP_223562619.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N8O08_RS17450 (N8O08_17450) | 3615116..3618262 | + | 3147 | WP_223562618.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| N8O08_RS17455 (N8O08_17455) | 3618773..3619147 | + | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
| N8O08_RS17460 (N8O08_17460) | 3619175..3619393 | + | 219 | WP_148244022.1 | HHA domain-containing protein | Toxin |
| N8O08_RS17465 (N8O08_17465) | 3619599..3620150 | + | 552 | WP_223562617.1 | maltose O-acetyltransferase | - |
| N8O08_RS17470 (N8O08_17470) | 3620268..3620735 | + | 468 | WP_223562616.1 | YlaC family protein | - |
| N8O08_RS17475 (N8O08_17475) | 3620707..3622167 | - | 1461 | WP_223562615.1 | PLP-dependent aminotransferase family protein | - |
| N8O08_RS17480 (N8O08_17480) | 3622269..3622979 | + | 711 | WP_223562614.1 | GNAT family protein | - |
| N8O08_RS17485 (N8O08_17485) | 3622976..3623116 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| N8O08_RS17490 (N8O08_17490) | 3623119..3623379 | - | 261 | WP_010428154.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8646.02 Da Isoelectric Point: 8.9008
>T259553 WP_148244022.1 NZ_CP104976:3619175-3619393 [Enterobacter sp. 155105]
MSDKPLTKFDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKFDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT259553 WP_008499288.1 NZ_CP104976:3618773-3619147 [Enterobacter sp. 155105]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|