Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 756859..757516 | Replicon | chromosome |
| Accession | NZ_CP104976 | ||
| Organism | Enterobacter sp. 155105 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W7P4L3 |
| Locus tag | N8O08_RS03650 | Protein ID | WP_023326024.1 |
| Coordinates | 757106..757516 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W7NX65 |
| Locus tag | N8O08_RS03645 | Protein ID | WP_006178375.1 |
| Coordinates | 756859..757125 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8O08_RS03620 (N8O08_03620) | 752041..753474 | - | 1434 | WP_223561484.1 | 6-phospho-beta-glucosidase BglA | - |
| N8O08_RS03625 (N8O08_03625) | 753591..754322 | - | 732 | WP_223563527.1 | MurR/RpiR family transcriptional regulator | - |
| N8O08_RS03630 (N8O08_03630) | 754374..754685 | + | 312 | WP_223561483.1 | N(4)-acetylcytidine aminohydrolase | - |
| N8O08_RS03635 (N8O08_03635) | 754851..755510 | + | 660 | WP_023333307.1 | hemolysin III family protein | - |
| N8O08_RS03640 (N8O08_03640) | 755584..756564 | - | 981 | WP_223561482.1 | tRNA-modifying protein YgfZ | - |
| N8O08_RS03645 (N8O08_03645) | 756859..757125 | + | 267 | WP_006178375.1 | FAD assembly factor SdhE | Antitoxin |
| N8O08_RS03650 (N8O08_03650) | 757106..757516 | + | 411 | WP_023326024.1 | protein YgfX | Toxin |
| N8O08_RS03655 (N8O08_03655) | 757523..758044 | - | 522 | WP_223561481.1 | flavodoxin FldB | - |
| N8O08_RS03660 (N8O08_03660) | 758146..759042 | + | 897 | WP_023309098.1 | site-specific tyrosine recombinase XerD | - |
| N8O08_RS03665 (N8O08_03665) | 759071..759784 | + | 714 | WP_029740340.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| N8O08_RS03670 (N8O08_03670) | 759790..761523 | + | 1734 | WP_223561480.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16063.06 Da Isoelectric Point: 10.9468
>T259546 WP_023326024.1 NZ_CP104976:757106-757516 [Enterobacter sp. 155105]
VVLWQSDLRVSWRSQWMSLLLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAIVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|